KEGG   Zymoseptoria tritici: MYCGRDRAFT_98802Help
Entry
MYCGRDRAFT_98802  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
Organism
ztr  Zymoseptoria tritici
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc Pyr_redox TrkA_N DUF4434 NAD_binding_7 Pyr_redox_2 2-Hacid_dh_C FAD_binding_3 Shikimate_DH
Motif
Other DBs
NCBI-GeneID: 13398817
NCBI-ProteinID: XP_003856650
JGI: Mycgr3_98802
UniProt: F9WYH6
LinkDB All DBs
Position
1
AA seq 358 aa AA seqDB search
MKAVRFHGKEDLRYEDIPEPKCGPGQVKVKPAWCGICGSDLHEYMGGPSLCPEKTPHPIT
GETVPLTFGHEFAGVIEEVGEGVSDRFKVGSRVVVAPIIYDGDCGACEDGLVNCCWKNGF
VGLSGWGGGLSEHLVVPEYTLYNCPDNVPLDVAALVEPLAVGWHAVASSPFQEGDSALIL
GGGPIGLSVIQALRARGCEKIIVSEISGMRKQFAKDFGAHYVLDPTKDDIVKRCLELTNN
KGVDVTFDAAGVQAGLDQAVNSLKARGTHVNIAIWEKRATFWPNDLVFKERKYLGVATYV
KADFQAVIDALSDGRLDMAQKMITKRIEMGEVLEEGFLTLINDKDNQVKILVKGSGEK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggtgcgatttcacggcaaagaagacctgcgatacgaggacattcccgaaccg
aaatgtggccccggccaggtcaaagtgaagccggcatggtgcggaatctgcggcagtgat
ctccacgagtacatgggcggtccatcactctgtccggaaaagacacctcatcccatcact
ggcgaaaccgtcccgttgactttcggccacgaattcgcgggcgtgattgaagaggtggga
gaaggcgtgtcggacagattcaaagtcggaagtcgcgtggtcgtcgctccgatcatctac
gatggtgactgcggtgcgtgcgaggatggattggtcaactgctgttggaagaatggattc
gtgggactgagtgggtggggaggtggactgtcggaacatttggtcgtgccggaatacaca
ctgtacaactgtccggacaatgtcccgttggatgtcgcagcgctggtggaaccgctcgca
gttggatggcatgctgttgcctcgtctccgttccaggagggcgattcggcgttgattctg
ggtggaggtccgatcggtctgtcggtgatccaagcgctacgagcacgaggatgtgagaag
atcatcgtgtcggagatttcgggcatgcggaaacaatttgcgaaagactttggcgcgcac
tacgttctggacccgacgaaggatgatattgtcaagaggtgtttggagctgacgaacaac
aagggagtggacgtgacatttgacgcagccggcgtgcaagcgggtctggatcaagctgtc
aactcgctgaaagcgcgagggacgcatgtcaacattgccatctgggagaagcgagcgacg
ttctggccgaatgatcttgtcttcaaggagagaaagtatctcggtgttgcgacatacgtc
aaggctgacttccaagcggtgattgatgcgctgagtgatgggagattggacatggcgcag
aagatgatcacgaagcgcattgaaatgggtgaggtgctggaggagggattcctgacgttg
atcaacgacaaggacaatcaggtgaagattttggtgaaggggagtggtgaaaagtag

DBGET integrated database retrieval system