KEGG   Zymoseptoria tritici: MYCGRDRAFT_99310Help
Entry
MYCGRDRAFT_99310  CDS       T02285                                 

Definition
(RefSeq) hypothetical protein
  KO
K09540  translocation protein SEC63
Organism
ztr  Zymoseptoria tritici
Pathway
ztr03060  Protein export
ztr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ztr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    MYCGRDRAFT_99310
   04141 Protein processing in endoplasmic reticulum
    MYCGRDRAFT_99310
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ztr03110]
    MYCGRDRAFT_99310
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ztr02044]
    MYCGRDRAFT_99310
Chaperones and folding catalysts [BR:ztr03110]
 Heat shock proteins
  HSP40 / DNAJ
   MYCGRDRAFT_99310
Secretion system [BR:ztr02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   MYCGRDRAFT_99310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ Shal-type
Motif
Other DBs
NCBI-GeneID: 13400702
NCBI-ProteinID: XP_003855162
JGI: Mycgr3_99310
UniProt: F9X3Z8
LinkDB All DBs
Position
2
AA seq 720 aa AA seqDB search
MSNEYNYDADAQFFPFFVLTMSSLVTIPLTYSLLKPTADVSQLRKAGHINSDFKPEHADI
INAQRTKQKRKELRLKRTIVAAIGWVTIAYMAYLMYITVRTAPVIWNPYEILDISMSATE
KQINSRYRRLSTTMHPDKRRPNEALNQTMETVNDEWVEIVKAYKALTDEEIRNNFIQYGN
PDGKQSTSFGIALPQFLVAGGAGKYVLAVYGLVLGIGLPYLIGKWWYGMQRLTKEGILTT
TAGDMFREYQDPMEGGDVLAAVATASEFKEILHGSKADSGLSTAEKKLSSSEYVNSVMRP
KDIKKLRELEDPVRRKTLALLWAYLTRLDLDDTTLEAEKFELPPTALRMEEAFVTICQSF
GMTTSLLSTFHLNQSLIQAIPPTKAGRSPLLQLPHFTPSIVRQIESSANSGSNHMTIQSF
MALPTEQRQSLASAAGLPTSHLKLAESVARQLPYLQIEKTFFKVQGEKLLTPSSLVNFVV
KARFIPPGTPASAIPPVNPDDLLDPDPAESDLNAQKVEPEKFDVPLAHAPYFARDRAPHW
YLFLADHRQGKIAVPPFKFTTFDKKAFDADGKPTFAVVTLKMTFAAPPQVGEYKFQMHLI
CDSYVGFDRTEDAVMNIEDASKLAEGDREDEISEPDEDTIAGQMAALQGKPTESKSHDHG
HSHGHAHPRRNEKLRKKLEEEESDYESGTDGSEDEESETDTDTDSEAEEAAKKEKKGWFS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaatacaactacgatgcggacgcgcaattctttcccttcttcgtcctgacg
atgagctcgctcgtcaccattcctctcacatactccctccttaagcccaccgccgacgta
tcgcaactccgaaaagccggacacatcaactccgacttcaagcccgagcacgccgacata
attaatgcccagcgcacaaagcaaaagcggaaggagctgcgactgaagaggacgatagtc
gccgcgataggatgggtcacaatcgcatacatggcctacctcatgtacattactgtgcga
acggcgcctgtgatctggaatccctatgagattctcgacatatccatgtcagccaccgag
aagcagatcaactcgcggtacaggagactgtcaaccaccatgcatcccgataagcgaaga
ccgaatgaagcgctgaatcagacgatggagacggtcaacgatgagtgggtggagattgta
aaagcatacaaggcgttgacggatgaggagattcggaacaactttattcaatatggaaac
ccagacggcaagcaaagcaccagttttggaatcgctctaccgcaattcctcgtcgcgggt
ggagctggaaagtacgtgctggctgtgtatggattggtactgggaattggtcttccatac
ctgattggcaagtggtggtacggcatgcagagattgaccaaggagggcattctcacgacg
actgctggtgacatgtttcgcgagtatcaggatccgatggaaggtggtgatgtcctcgcc
gctgtcgcgactgcatcagagttcaaggagattcttcacggctccaaggcagacagcggg
ctcagcacggctgagaagaaattgtcatcttcagaatatgtcaactccgtcatgcgaccc
aaggatatcaagaaactgcgagagctcgaggatcccgttcgcagaaagacactcgctctg
ctctgggcatatctcacacgactcgatttggacgacaccacactggaggccgaaaagttc
gagctcccacccaccgcactgcgaatggaggaggccttcgtcaccatctgccagtccttt
ggcatgaccacatcactcctttccaccttccacctcaaccaaagtctgattcaagccatc
ccaccaaccaaagccggtcgatcaccactccttcaactgccacactttactccgagcatt
gtccgtcaaattgagtcctctgcaaacagcggcagcaatcacatgaccatccaatccttc
atggctcttcccaccgaacaacgccaatccctcgccagcgcagccggcctccccacctcg
cacctcaaactcgccgagtccgttgcccgccaacttccttacctccaaatcgaaaagacc
ttcttcaaagtccaaggcgaaaaactcctcactccatcctccctcgtcaacttcgtcgtc
aaagcccgcttcatcccacccggtactcccgcctccgccatcccacccgtcaacccagat
gacctcctcgacccggaccccgccgaaagcgacctcaacgcgcaaaaagtcgaacccgag
aaattcgacgtgcccctcgctcatgcaccatacttcgcccgcgaccgcgccccgcactgg
tacctcttcctcgccgaccatcgacagggcaaaatcgccgtcccaccgttcaaattcacg
acgtttgacaagaaggctttcgatgcggacggcaagcctacatttgcggtggttacactg
aagatgacctttgccgcgccgccgcaggtcggagagtataaattccaaatgcatttgatt
tgtgatagttatgtcggtttcgatcgtacggaagacgcggtgatgaatatcgaggacgcg
agtaaacttgccgagggagatcgggaggatgaaatttcggagccggatgaagataccatc
gccggccaaatggccgcattgcagggtaaacccacggagagcaagtctcacgatcatggt
cactctcatggtcacgcgcatccgagaaggaatgagaaattgaggaagaagttggaggag
gaggagagtgattatgagagtggcacggatgggagtgaagatgaggagagcgagacggat
acggatacggattcggaagcggaggaggcggcgaagaaggagaagaaggggtggttctcg
tga

DBGET integrated database retrieval system