KEGG   Zymoseptoria tritici: MYCGRDRAFT_99732Help
Entry
MYCGRDRAFT_99732  CDS       T02285                                 

Gene name
KGD1
Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ztr  Zymoseptoria tritici
Pathway
ztr00020  Citrate cycle (TCA cycle)
ztr00310  Lysine degradation
ztr00380  Tryptophan metabolism
ztr01100  Metabolic pathways
ztr01110  Biosynthesis of secondary metabolites
ztr01130  Biosynthesis of antibiotics
ztr01200  Carbon metabolism
Module
ztr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ztr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCGRDRAFT_99732 (KGD1)
  Amino acid metabolism
   00310 Lysine degradation
    MYCGRDRAFT_99732 (KGD1)
   00380 Tryptophan metabolism
    MYCGRDRAFT_99732 (KGD1)
Enzymes [BR:ztr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MYCGRDRAFT_99732 (KGD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 13404539
NCBI-ProteinID: XP_003854090
JGI: Mycgr3_99732
UniProt: F9X732
LinkDB All DBs
Position
3
AA seq 1057 aa AA seqDB search
MLSSATCLRSKRLAIGSSAARAFSSISSTAPRPALLTKRRELGLTTYKALTSQNRSYAVA
AEDTNKGVDASDSFLSGNTANYVDAMYAEWKHDPSAVHASWNAYFKNMDNGDMPVSRAFT
PPPTIVPTPAGGVPAPNFGAVGAAQGQGGEVLSHLKVQLLVRAYQARGHHKAKIDPLGIR
SQDSLSGTVPKELELSTYDFTEADMETEFSLGPGILPRFKTETRDKMTLREIIDNCERLY
CGSYGIEYIHIPDRAQCDWLRQRIEVPQPFKYSVDEKRRILDRMIWSSSFESFLATKYPN
DKRFGLEGGESLIPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFG
GSAAPSDEGSGDVKYHLGMNFERPTPSGKRVNLSLVANPSHLEAEDPVVLGKTRAILHYN
GDEENATSAMGVLLHGDAAFAAQGVVYETMGFYALPAYQTGGTVHLIVNNQIGFTTDPRF
ARSTPYCSDLAKFVDAPVFHVNGDDVEALNFVCQMAADWRAEFKKDVIVDIVCYRKQGHN
ETDQPSFTQPLMYKKISEQVPTLDKYVKQLIDANTFTKEDVDEHKKWVWNTLEESFEKSK
DYTPTAKEWLTSAWHGFKSPKELATEVLPHLPTGIKAETLKHIAKVIGEPPEGFNVHRNL
KRILANRTKSVNEGKNIDMSTAEALAFGSLCLEGKHVRVSGQDVERGTFSQRHAVLHDQE
SEKTHTPLRNLGDDQGTFVIANSSLSEFGALGFEYGYSLSSPNALVIWEAQFGDFANNAQ
CIIDQFIASGEVKWLQRSGLVMNLPHGYDGQGPEHSSGRMERFLQLCNEDPRIFPKPDKL
DRQHQDCNMQITYCTTPANYFHILRRQMNRQFRKPLINFFSKSLLRHPLARSNIEDLEGE
SHFQWIVPDPAHDANAEFKIDSHDKIKRVILCSGQVFAALFKHREANKLTDTAITRIEQL
NPFPWAQLKENLDSYPNAETIVWCQEEPLNAGAWSFAQPRIETLLNNTEHHDRKHVMYAG
RNPSASVATGLKSSHMKEEQDLLKMAWSVHQDKLKGE
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctccgcaacatgcctccgcagtaaacgactggccatcggtagctccgccgcc
agagctttctcgtccatctcctccaccgctccacgacccgcgctcttgacgaaacgacgg
gaactcggcctgaccacatacaaggccctcacgtcgcaaaatcgcagctatgccgtcgcc
gctgaagacacaaataagggcgtcgacgcctccgactcattcctgtcagggaataccgcc
aactatgtcgatgccatgtatgccgagtggaagcatgacccatcagcggtgcacgcctca
tggaacgcgtactttaagaacatggacaacggcgacatgccagtcagccgcgctttcaca
ccacctccaactattgttccaaccccagctggaggtgttccagcaccaaactttggcgct
gttggagctgcgcaaggacagggtggcgaggtgctgagccatttgaaggtgcagctcctt
gtgcgtgcataccaagctcgaggacaccacaaggcaaagatcgaccccctcggtatcaga
agtcaggactccctcagtggcaccgtccctaaggagctggagctatccacatacgacttc
accgaggccgacatggagacggagttttcattgggacccggtattctcccccgtttcaag
acagagactcgcgataagatgactctccgtgagatcatcgacaactgtgagcgcctttac
tgcggctcttacggtatcgagtacatccacattccggaccgagcgcaatgtgactggctc
cgacagagaatcgaggttccacagcccttcaaatactctgtcgacgaaaagcgaagaatt
ctggacaggatgatctggtcttcttcattcgagtctttcctcgcgaccaagtatcccaac
gacaagcgtttcggtcttgagggtggagagtcactcattcctggtatgaaggctttgatc
gatcggtccgtagactacggcgtcaaggacattgtcattggtatgccacacagaggtcga
ttgaacgtgctgtccaacgtggtccgcaagcccaacgagtctatcttctcagaatttgga
ggctccgccgcgccttctgacgagggatctggtgatgtcaagtaccacttgggtatgaac
ttcgagcgacccactccatccggcaagcgcgtgaacctttccctcgtggccaacccatcc
catttggaggccgaggatccagtcgtgcttggcaagactcgcgcgatcctccactacaac
ggcgatgaggagaatgcgacctccgccatgggtgtccttctccacggtgacgccgctttc
gctgctcagggtgtcgtgtacgagaccatgggattctatgcgcttcctgcgtaccagacc
ggaggaaccgtccatctcatcgtcaacaaccagattggtttcaccactgacccacgcttc
gctcgctctaccccatactgctcagacctcgccaagtttgtggatgctccggtgttccac
gtcaacggtgatgatgttgaggctctcaactttgtctgccaaatggccgccgattggcgt
gcggagttcaagaaggacgtcattgtcgacattgtctgctaccgcaaacaaggtcacaac
gagactgatcagccatctttcactcagccactcatgtacaagaagatcagcgagcaagtt
ccaaccctcgacaagtacgtcaagcaactcatcgatgccaacactttcacaaaggaggac
gtcgacgagcacaagaagtgggtctggaacaccctcgaggagtcgtttgagaagtcgaaa
gactacacaccaacagccaaggagtggctgaccagcgcatggcacggcttcaagtcaccc
aaggagcttgccaccgaagttctgccccatctgccaaccggcatcaaggccgagaccctg
aaacacatcgcaaaggtcatcggcgagccgccagagggcttcaacgtccaccgcaacctc
aagcgcattttggccaaccgcacaaagtctgtcaacgagggcaagaacattgacatgtcc
actgcggaggctctggcctttggttctctctgcttggagggcaagcacgttcgcgtgtct
ggtcaagatgtcgagcgtggcaccttctcccagcgtcacgcagtcttgcacgaccaggag
agtgaaaagacccacactcctctaaggaatctcggcgacgaccagggtacctttgtcatc
gccaactctagtttgagcgagtttggtgctctcgggttcgaatatggctactcactgtcc
tcgccaaacgctctcgtcatctgggaggcgcaattcggtgactttgccaacaacgcccaa
tgtatcatcgatcaattcatcgcctccggtgaagtcaagtggctgcaacgatccggtctg
gtcatgaacttgccccacggctacgacggccaaggtcccgagcacagttccggccgcatg
gagcgcttcttgcagctttgcaacgaggacccacgcatcttccccaagcctgacaagctc
gaccgtcaacaccaggactgcaacatgcaaatcacctactgcacgacacccgccaactac
ttccacatcctccgtcgccagatgaaccgtcaattccgcaagcctctcatcaacttcttc
tccaagagcttgctccgtcacccactcgcccgctccaacatcgaggacctcgagggcgag
tctcacttccaatggatcgtcccggacccagctcacgatgccaacgccgagttcaagatt
gactcgcatgacaagatcaagcgcgtgatcctctgctctggccaagtcttcgccgcattg
ttcaagcaccgggaagccaacaaactcaccgacactgccatcacccgtatcgagcaactc
aaccccttcccttgggctcagctcaaggagaacttggactcctacccgaacgccgagacg
atcgtctggtgtcaggaggagccgcttaatgccggcgcgtggtcgtttgctcagccgaga
atcgagacgctgttgaacaacactgagcaccacgacaggaagcatgtcatgtatgctggt
cgcaacccgagtgcgtctgtcgcgaccggtttgaagagcagccatatgaaggaggagcag
gacttgttgaagatggcttggagtgtgcatcaggataagctgaagggcgagtag

DBGET integrated database retrieval system