KEGG   ORTHOLOGY: K21807
Entry
K21807                      KO                                     
Symbol
E6
Name
HPV protein E6
Pathway
map04061  Viral protein interaction with cytokine and cytokine receptor
map05165  Human papillomavirus infection
map05203  Viral carcinogenesis
Network
nt06114  PI3K signaling (viruses)
nt06116  NOTCH signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06130  Cell cycle (viruses)
nt06131  Apoptosis (viruses and bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06140  Transcription (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00341  HPV E6 to the Scribble/Dlg/Lgl polarity module
N00343  HPV E6 to MAGI-PTEN signaling pathway
N00345  HPV E6 to CRB3-Pals1-PATJ complex
N00346  HPV E6 to TLR-IRF3 signaling pathway
N00348  HPV E6 to p300-p21-Cell cycle G1/S
N00349  HPV E6 to p300-p21-Cell cycle G1/S
N00350  HPV E6 to extrinsic apoptotic pathway
N00351  HPV E6 to extrinsic apoptotic pathway
N00352  HPV E6 to extrinsic apoptotic pathway
N00353  HPV E6 to PTEN-PIP3-AKT signaling pathway
N00354  HPV E6 to PTEN-PIP3-AKT signaling pathway
N00357  HPV E6 to MTOR signaling pathway
N00358  HPV E6 to p21-cell cycle G1/S
N00373  HPV E6 to NFX1-mediated transcription
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
N00383  HPV E6 to intrinsic apoptotic pathway
N00384  HPV E6 to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:ko00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04061 Viral protein interaction with cytokine and cytokine receptor
    K21807  E6; HPV protein E6
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    K21807  E6; HPV protein E6
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    K21807  E6; HPV protein E6
 09180 Brite Hierarchies
  09185 Viral protein families
   03200 Viral proteins
    K21807  E6; HPV protein E6
Viral proteins [BR:ko03200]
 dsDNA viruses
  Human papillomavirus
   K21807  E6; HPV protein E6
Genes
VG: 12218716(E6) 13097024(E6) 13097038(E6) 1403312(E6) 1489006(E6) 1489078(E6) 1489088(E6) 1489225(E6) 1489368(E6) 1489375(E6) 1489424(E6) 1489431(E6) 1489464(E6) 1489472(E6) 1496946(E6) 1497432(E6) 6334561(E6) 951486(E6)
Reference
PMID:8598912
  Authors
Klingelhutz AJ, Foster SA, McDougall JK
  Title
Telomerase activation by the E6 gene product of human papillomavirus type 16.
  Journal
Nature 380:79-82 (1996)
DOI:10.1038/380079a0
  Sequence
[vg:1489078]
LinkDB

KEGG   Homo sapiens (human): 7337
Entry
7337              CDS       T01001                                 
Symbol
UBE3A, ANCR, AS, E6-AP, EPVE6AP, HPVE6A, PIX1
Name
(RefSeq) ubiquitin protein ligase E3A
  KO
K10587  ubiquitin-protein ligase E3 A [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
Network
nt06114  PI3K signaling (viruses)
nt06130  Cell cycle (viruses)
nt06131  Apoptosis (viruses and bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06140  Transcription (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00341  HPV E6 to the Scribble/Dlg/Lgl polarity module
N00343  HPV E6 to MAGI-PTEN signaling pathway
N00345  HPV E6 to CRB3-Pals1-PATJ complex
N00357  HPV E6 to MTOR signaling pathway
N00358  HPV E6 to p21-cell cycle G1/S
N00373  HPV E6 to NFX1-mediated transcription
N00383  HPV E6 to intrinsic apoptotic pathway
Disease
H01732  Angelman syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7337 (UBE3A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    7337 (UBE3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7337 (UBE3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7337 (UBE3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     7337 (UBE3A)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   7337 (UBE3A)
SSDB
Motif
Pfam: HECT AZUL PCM1_C
Other DBs
NCBI-GeneID: 7337
NCBI-ProteinID: NP_000453
OMIM: 601623
HGNC: 12496
Ensembl: ENSG00000114062
Pharos: Q05086(Tbio)
UniProt: Q05086
Structure
LinkDB
Position
15:complement(25333728..25439056)
AA seq 875 aa
MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTF
LRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARI
DFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKS
LQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIR
RVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPE
YLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRN
LVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNK
KGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTC
PFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRL
EMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFW
FNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQ
SLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDY
ILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGY
TRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTS
HTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
NT seq 2628 nt   +upstreamnt  +downstreamnt
atggagaagctgcaccagtgttattggaaatcaggagaacctcagtctgacgacattgaa
gctagccgaatgaagcgagcagctgcaaagcatctaatagaacgctactaccaccagtta
actgagggctgtggaaatgaagcctgcacgaatgagttttgtgcttcctgtccaactttt
cttcgtatggataataatgcagcagctattaaagccctcgagctttataagattaatgca
aaactctgtgatcctcatccctccaagaaaggagcaagctcagcttaccttgagaactcg
aaaggtgcccccaacaactcctgctctgagataaaaatgaacaagaaaggcgctagaatt
gattttaaagatgtgacttacttaacagaagagaaggtatatgaaattcttgaattatgt
agagaaagagaggattattcccctttaatccgtgttattggaagagttttttctagtgct
gaggcattggtacagagcttccggaaagttaaacaacacaccaaggaagaactgaaatct
cttcaagcaaaagatgaagacaaagatgaagatgaaaaggaaaaagctgcatgttctgct
gctgctatggaagaagactcagaagcatcttcctcaaggataggtgatagctcacaggga
gacaacaatttgcaaaaattaggccctgatgatgtgtctgtggatattgatgccattaga
agggtctacaccagattgctctctaatgaaaaaattgaaactgcctttctcaatgcactt
gtatatttgtcacctaacgtggaatgtgacttgacgtatcacaatgtatactctcgagat
cctaattatctgaatttgttcattatcgtaatggagaatagaaatctccacagtcctgaa
tatctggaaatggctttgccattattttgcaaagcgatgagcaagctaccccttgcagcc
caaggaaaactgatcagactgtggtctaaatacaatgcagaccagattcggagaatgatg
gagacatttcagcaacttattacttataaagtcataagcaatgaatttaacagtcgaaat
ctagtgaatgatgatgatgccattgttgctgcttcgaagtgcttgaaaatggtttactat
gcaaatgtagtgggaggggaagtggacacaaatcacaatgaagaagatgatgaagagccc
atccctgagtccagcgagctgacacttcaggaacttttgggagaagaaagaagaaacaag
aaaggtcctcgagtggaccccctggaaactgaacttggtgttaaaaccctggattgtcga
aaaccacttatcccttttgaagagtttattaatgaaccactgaatgaggttctagaaatg
gataaagattatacttttttcaaagtagaaacagagaacaaattctcttttatgacatgt
ccctttatattgaatgctgtcacaaagaatttgggattatattatgacaatagaattcgc
atgtacagtgaacgaagaatcactgttctctacagcttagttcaaggacagcagttgaat
ccatatttgagactcaaagttagacgtgaccatatcatagatgatgcacttgtccggcta
gagatgatcgctatggaaaatcctgcagacttgaagaagcagttgtatgtggaatttgaa
ggagaacaaggagttgatgagggaggtgtttccaaagaattttttcagctggttgtggag
gaaatcttcaatccagatattggtatgttcacatacgatgaatctacaaaattgttttgg
tttaatccatcttcttttgaaactgagggtcagtttactctgattggcatagtactgggt
ctggctatttacaataactgtatactggatgtacattttcccatggttgtctacaggaag
ctaatggggaaaaaaggaacttttcgtgacttgggagactctcacccagttctatatcag
agtttaaaagatttattggagtatgaagggaatgtggaagatgacatgatgatcactttc
cagatatcacagacagatctttttggtaacccaatgatgtatgatctaaaggaaaatggt
gataaaattccaattacaaatgaaaacaggaaggaatttgtcaatctttattctgactac
attctcaataaatcagtagaaaaacagttcaaggcttttcggagaggttttcatatggtg
accaatgaatctcccttaaagtacttattcagaccagaagaaattgaattgcttatatgt
ggaagccggaatctagatttccaagcactagaagaaactacagaatatgacggtggctat
accagggactctgttctgattagggagttctgggaaatcgttcattcatttacagatgaa
cagaaaagactcttcttgcagtttacaacgggcacagacagagcacctgtgggaggacta
ggaaaattaaagatgattatagccaaaaatggcccagacacagaaaggttacctacatct
catacttgctttaatgtgcttttacttccggaatactcaagcaaagaaaaacttaaagag
agattgttgaaggccatcacgtatgccaaaggatttggcatgctgtaa

DBGET integrated database retrieval system