KEGG   T30146 (Metagenome): 69152
Entry
69152             CDS       T30146                                 

Name
glutaryl-7-aminocephalosporanic-acid acylase
  KO
K06978  uncharacterized protein
Best hit
bvu:BVU_1858 (best score: 241.891)
Taxonomy
Bacteroidetes [GN:bvu]
Other DBs
HMP: SRS011134.69152-T1-C
LinkDB
Position
C4747675:complement(2..319)
AA seq 106 aa
LWNDIKNHPDFDDFWKERDARTSCYNLKPAILVVGGLYDSEDCYGAWNLYKAIKEQSPDT
DLYLTFGPWWHGAWTVRGFQGFGNLYFGKSTSAYYMDKIEYPFFRY

DBGET integrated database retrieval system