KEGG   T30595 (Metagenome): 2211
Entry
2211              CDS       T30595                                 

Gene name
ftsI
Definition
penicillin-binding protein
  KO
K08724  penicillin-binding protein 2B
Best hit
ljo:LJ_0969 (best score: 417.927)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.2211-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_594:1802..2779
AA seq 326 aa
MNNKKIVRKVSKSHVNRNVVGRLLQISMAFVFLLFVGRFLYLSISKTIAGENISERVGNL
YKRDEILKSVRGAIYDNSGNVIAEDSHSFTLYAILDKSSLDYKGKPMYVVDKKKTAEKLS
TVIPLSEKKILKYLHPKHKAYQVEFGTAGSGISLATKKKIMAMHLPGIHFDETPSRLYPN
GRFASHIIGIAQPFNDKKNHSINLIGTMGIEKYFNKVLSGKDGRRIALVDAGEYQLPGGQ
HSYKAPINGNNIYLTIDSQLQIYLENLLDAVQNKYKPKALTAIVEDVKTGKIMAASQRPT
FDPATRKGLNDNWRNILVQDSYEPGS

KEGG   T30595 (Metagenome): 2735
Entry
2735              CDS       T30595                                 

Definition
cell division protein ftsI/penicillin-binding protein 2
  KO
K08724  penicillin-binding protein 2B
Best hit
ljo:LJ_0969 (best score: 1358.97)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.2735-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_748:complement(24048..26198)
AA seq 716 aa
MKKFNNLNRNRSKAHGYRFTVGRILQLVLALVFLVFIGRFLYIGISNQVAGENLNKRVNQ
IYRRNEVLKATRGTIYDKNGLTLAEDAHVFTIYAILDKSSIDYHNKPMYVTNKHKTAQKL
AEVLPLSEEKIYSYLTPKHKAFQVEFGSAGTGLTLSQKKKIEAMKLPGIKFIETPSRLYP
NGNFASHIIGLAQPQKSQGTSNLVGTMGIEAYFDKQLAGKDGYREAFVDAENYQLPNGQK
ATRATQDGDNIYLTLDSRLQSYLEVLMSQVQDKYKPKALTAVVEDIQTGKILAASQRPTF
NPQTKQGLDTSWRNILVQDSYEPGSVFKVLTYSSAIESGNYNPNEQYKSGAVTVQGSTIH
DWNNSGWGSIPFSQAFPRSSNVGFVKLEQKMGAKTWKEYLNKYRIGKKTGVTLPGETAGI
LNFSTPLNQAVTAFGQGVNVNAMQMMQAYSALANNGQMVKPQFVEKIVSPSGKVVEKFHR
TKVGTPIYSAKTAKTVLKGMQDVVNASYGTGAAYKMPGKSIAVKTGTAQIAGPHGGYLTG
DNNYIFSVVGVTPANNPRYCVYLTMKQPQKMSKPAETILSSIFKPIMNRLISLSDSTAKI
NEKVTVPALTGKSVEKAKEEANNAGVSIEIIGTGKTVSRQSVSAGVKQGTDDKIFLFTGG
QVTCPNMVGWTESEVNSFMTTTDIPITINGKGKVTKQSIPSGKVIDKNSKLSVNLK

KEGG   T30595 (Metagenome): 6332
Entry
6332              CDS       T30595                                 

Definition
penicillin-binding protein 2B
  KO
K08724  penicillin-binding protein 2B
Best hit
ljo:LJ_0969 (best score: 884.019)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.6332-T1-C
LinkDB
Position
C128261:complement(2251..4413)
AA seq 720 aa
MKNSSNIKTTKTNVHSNRFQVGRVLQVIVALVFLIFLGRTLYISISKTVAGENLSTRTAA
LYKRNQVLKATRGTIYDRNGFTIAEDSHVYTVYAILDHSSINYKNKPEYVVDKDKTAEKL
ATVLPLSKEQILKYLNPKTKAFQVQFGSGGSNLTIEQKKKIEQMKLPGIKFIEAPSRLYV
NGVFASHIVGLAQPIYNKKTKSTDLVGTMGIEAYYDKYLAGKDGFKESSVDASEYQLPNG
TNAYRAAKNGDDIYLTLDSQLQNYMENLLTRVQNKYQSKALTAVVEDLRTGKVLAASQRP
TFDSQTKKGLTSSYTDLLTQSTFEPGSVFKILSFAAAINSGHYNPNELYKSGSLTVNGST
IHNWNVTGWGSIPLYEAFPRSSNVGLSILEQKMGATTWRSYLNKFGITKKTGITLPGEQA
GMIAFKSKLDQAVTSFGQGVNVNVWQMMQAYSILANKGQMVKPQLVEKIVSPSGKVIQNY
KVQKVGKKVVSESTVKTVLQGMQDVVNKQYGTGTTYKIAGKSIAVKTGTAQIAGPNGYLT
GNNNYIFSVIGVTPANNPHYAIYLTMKQPQKMTDPAETILASIFKPMMNRLILSSSVTKK
ASASKEEVPNVIGKSITNAKNDIEKVALSVEVLGSGDVVTQQTPATGQKLTAGSKVFVLT
SGKIAAANFTNWTVEEVKQYAALAGISVKVSGSEDGKVKSQNIKVGTLLKSGQEIIIKTK

KEGG   T30595 (Metagenome): 2705
Entry
2705              CDS       T30595                                 

Gene name
ftsI
Definition
penicillin-binding protein
  KO
K08724  penicillin-binding protein 2B
Best hit
ljo:LJ_0969 (best score: 368.622)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.2705-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_744:3..758
AA seq 252 aa
DSYEPGSVFKILSITAAIQEGKYNPKEYYRSGSITFNGSTIHDWNYTGWGAMPFEQAFPR
SSNVGMSILVNRLGRHTWRRYLDNYHIGKKTNITLPDENSGLINIHSQIDQAVTSFGQGI
NVNAMQMMQVYSALANSGQMLKPQLVEKIVSSSGKVIKRYKKIKVGKPVYSQETAQTTLK
LMRDVVEKEYGTGMTYKIPGKSIAVKTGTAQIAGIHGGYLKGDRNYLFSVVGLTPADNPR
YCIYITMKQPQI

KEGG   T30595 (Metagenome): 4678
Entry
4678              CDS       T30595                                 

Definition
penicillin binding protein, transpeptidase domain
  KO
K21465  penicillin-binding protein A
Best hit
ljo:LJ_1620 (best score: 305.064)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.4678-T1-C
LinkDB
Position
C124592:complement(2..550)
AA seq 183 aa
KKSVYPIGIFSSLDAETALEVSSNIYMMQLTLRWLNAKYTPKTYIHMPSDAFDILRRNFA
MFGLGQKTGIDLPGEISGIQGKSYNSSGQLLSGSVLDESYGNYDAYTPIQLAQYISTIAN
GGYRMQPYLVQSVGQTNSSGTKVSINYSKTPNVQFRIPWTSSELNVIKTGMYRVVHGTNA
WGT

KEGG   T30595 (Metagenome): 193
Entry
193               CDS       T30595                                 

Definition
cell division protein ftsI/penicillin-binding protein 2
  KO
K21465  penicillin-binding protein A
Best hit
ljo:LJ_1620 (best score: 1253.04)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.193-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_40:19751..21790
AA seq 679 aa
MKIILGVILVLFLLLIGQLAYLQLFYGGRFQAEVQQTDQKIVSNNVPRGVMYDSSGKILV
GNKANNAITYTKNSSITSSQIYKVSNRLSQYITLDDEKPTKRQLYDYYLANSKISEKETA
KLPKSERYDSNGDALSSSQIYNNVLKRVEKQNIHFTKRQKTAALIFNKISGAYTLSTIYI
KNKGLTDREMALVGEHLSELPGVGIGTDWSRSYPNGKSIKSIIGSVSSEKAGLPSDNLQY
YLTQGYSRNDRVGTSYLEEKYEPLLKGTKSKSQVVTKAKDGVEQTKTVYKGQSGASLILT
MNAKYQQEVEKTLKKVYASAQAAGATQYSNGAYAVAMNPKTGALLAIAGIDHNAKTGKNT
DDALGVINKSFVMGSAIKGATVAGGLMNGIISPTNSVMPDTPIYLPGSPIKKSVYPVGTF
SSLDAPTALEVSSNIYMMQLALRWVNAKYTPHSFISMPSDAFTKLRRNFAMFGLGQKTGV
DLPGEVSGIQGRSYNSAGQLLSGSVLDLAYGNYDAYTPIQLVQYVSTIANGGYRMRPYLV
QSVGETNAQGNKVSILYNNKPQVQMRIPWTQDQLDVIHQGFYRVVHGTNSWGTAHSLKDV
KPSISGKTGTAQTFYYDEDNPGNPKAPEVINATFVGYAPSKDPKLAVAVVFPGLDPDKEG
KYTLEVAKAMVQDYFKLNK

KEGG   T30595 (Metagenome): 6213
Entry
6213              CDS       T30595                                 

Definition
penicillin binding protein, transpeptidase domain
  KO
K21465  penicillin-binding protein A
Best hit
ljo:LJ_1620 (best score: 181.03)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.6213-T1-C
LinkDB
Position
C128099:complement(2..448)
AA seq 149 aa
VRLIFLNFLQNNNHKSDRKAAETPIRMKIILGVIFILFAMLIGQLAYLQLIYGSRFHSEV
QKTDDTVVTSAVPRGIMYDDKGRVLVGNKANNAITYTKGSSVTSKQIYNISTALSQYITI
SNEKPTALQLAAYYLGNSRNYAKEYAKLP

KEGG   T30595 (Metagenome): 3368
Entry
3368              CDS       T30595                                 

Definition
penicillin-binding protein, transpeptidase domain protein
  KO
K21465  penicillin-binding protein A
Best hit
ljo:LJ_1620 (best score: 997.653)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.3368-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_872:complement(45..2066)
AA seq 673 aa
ICVLFLLLIGQLAYLQLIYGGRFQTEVQKTDKKIVCNNVPRGVMYDSKGRILVGNKANNA
ITYTKNSNLTTAKIYDISEKLSKYIRLNDETPTKHQLFDYYLANSKNALKINRQLPRNQR
YDEHGDALDDHIVYQNTLKYLRSKKLVFSKRQKTAALIFNKISGAYTLSTIYIKNKHITG
KELTLVGENLSELPGVGIGTDWSRDYPNGESIKSIIGSVSSEKAGLPNTNLQYYLSQGYS
RNDRVGTSYLEEKYEPLLKGTKSKSQVISKHKSDSIDQTKTIYKGESGASLILTINSKYQ
KKVDKALKTVYNEAQRAGATRYSSGAYAVAMNPKTGALLAITGLMHNTKNNKIVDNALGV
INQAYVMGSVVKGAMVSGGLLNNVITPANNTLPDVPIYLPATPVKKSVYPIGTFGALNAP
TALEVSSNIYMMQLALRWLHAKYVPKSYISVPKNAFTILRRNFAMFGLGQKTGIDLPGES
HGITGRSFDKNGNILSGSVLDLSYGNYDAYTPIQLVQYISTIANGGYRMKPYLVQSIGKT
DPHNNKISILYNTKPKVQMCVPYKKDQLDVIKKGLYQVVHGTNGWGTGRFLKKEKPAIAG
KTGTAETFFFDPEHPGNIHAPEVINATFVGYAPADNPKIAVAVVFPGLNPNLEGTFTLQV
AKAMFNNYFKMYK

KEGG   T30595 (Metagenome): 5066
Entry
5066              CDS       T30595                                 

Definition
penicillin binding protein, transpeptidase domain
  KO
K21465  penicillin-binding protein A
Best hit
ljf:FI9785_1414 (best score: 433.335)
Taxonomy
Firmicutes - Bacilli [GN:ljf]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.5066-T1-C
LinkDB
Position
C126088:complement(2..883)
AA seq 294 aa
PKSQKYDSDGNELSNSTVYSTLEKQVIKNKRHYTSREKTAALIFNKISGAYSLSTIYIKN
QNLTDKEVALVGEHLSELPGVGIGTDWERTYPNGSSIKTIIGSVSSEKAGLPSEKLQYYL
AQGYSRNDRVGTSYLEKEYEALLKGSKTESKLTTKSNGKVTQTKTVYKGQAGASLILTLD
SKYQAKVQKKLKSVYSSALSAGAAHYSSGAFAIALDPNTGAIKAVAGLDHNVKTNKITDD
ALGIINQSFVMGSVVKGAQVAGGLINKVITPSSNTLPDTPIYLPGTPVKKSVYP

KEGG   T30595 (Metagenome): 5164
Entry
5164              CDS       T30595                                 

Definition
penicillin binding protein, transpeptidase domain
  KO
K21465  penicillin-binding protein A
Best hit
ljo:LJ_1620 ljf:FI9785_1414 (best score: 131.339)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.5164-T1-C
LinkDB
Position
C126350:1..303
AA seq 100 aa
TNAWGTAHTLKSVKPSISGKTGTAQTFYYDASASKKKNSSSDPIELINATFVGFAPSNKP
KLAVVVVFPGLDPNLEGTYTLQVAKEMVEDYFKLNKYAEN

KEGG   T30595 (Metagenome): 3786
Entry
3786              CDS       T30595                                 

Definition
penicillin-binding protein
  KO
K21465  penicillin-binding protein A
Best hit
lre:Lreu_1211 (best score: 136.346)
Taxonomy
Firmicutes - Bacilli [GN:lre]
Pathway
00550  Peptidoglycan biosynthesis
Other DBs
HMP: SRS047335.3786-T1-C
LinkDB
Position
C120808:3..299
AA seq 99 aa
EKFNTVKFFDRITNYFSSNKGKHKNAQSIIPSRLNLLLWIVGILLLMLAGRLFYLQVLNG
SSYKAEVKRSDTTIQTNNVQRGMIYDSRGKVIVGNQTHQ

DBGET integrated database retrieval system