KEGG   T30595 (Metagenome): 5192
Entry
5192              CDS       T30595                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Best hit
ljo:LJ_0928 (best score: 238.424)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.5192-T1-C
LinkDB
Position
C126402:complement(2..433)
AA seq 144 aa
MNLKSGIAKLSGKTSHWVLHNIFKGGTSFPGKLAMRIDPNILANLAKDYETIIVTGTNGK
TMTTALIVNALKEKYGEILTNPSGSNMQQGIITAFLSHKAKRHGRKLAVLEVDEANVKRV
TELLHPKAYVLTNIFRDQMDRYGE

KEGG   T30595 (Metagenome): 5572
Entry
5572              CDS       T30595                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Best hit
ljo:LJ_0928 (best score: 444.891)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.5572-T1-C
LinkDB
Position
C127131:complement(635..1528)
AA seq 297 aa
GIKLAPDAVVIANGDASIFSSVELPNKKVFYGFETKADEMTNDFRASVNTDGVLCPRCNH
IIHYHAISYANLGDFFCPNCGFKRPNLSYKLKEITERTPNSIKFRIENTEFSIGIGGTYN
IYNALAAFSVAREFDVSEDEIASAFAKNKRIFGRQELISYADKEINLILVKNPVGLNEVL
SLLNTEKSDYTLATLLNAHHADGIDTSWIWDADYEGLDKTKVKQILVGGERHHDMGFRLE
VAGFDPGTMEVTPDDNTLLTRIKEAPTKKVYILATYTAMLALRSTLYDQKILKNKIN

KEGG   T30595 (Metagenome): 3439
Entry
3439              CDS       T30595                                 

Definition
mur ligase middle domain protein
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Best hit
ljo:LJ_0928 (best score: 288.5)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.3439-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_901:complement(1060..1659)
AA seq 199 aa
TPKSLTFKMGTKVYQMAIGGTYNIYNALAAYSVAKEFGLSDDEIARSFSKNKRIFGRQEL
INYSDKEIILILVKNPVGLDSVLNMLNTENDDYSLITLLNANHADGIDTSWIWDSNYESL
HKENIKHILVGGLRHQDMHLRLKVAGFDPKIMETTPTDDELIDAIPNLPCKKIYILSTYT
AMLSLRKKMAERKIINVNM

KEGG   T30595 (Metagenome): 841
Entry
841               CDS       T30595                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Best hit
ljo:LJ_0928 (best score: 876.315)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.841-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_151:95..1447
AA seq 450 aa
MNLKSGIAKVAGKSSYWFLHNVLKGGTSFPGKFAMKIDPEVLNSLAKGYETIIVTGTNGK
TMTTALIVEALKKKYGDILTNPSGSNMQQGIVTAFLAHKNKKAKKKIAVLEVDEANVKMV
TKLLHPSVFVLTNIFRDQMDRYGEIYTTYQKIVDGIKLAPNATIIANGDASIFSSVELPN
KKVFYGFKLPDDKAENDFKAPVNTDGVLCPKCDHILHYHERVYANLGDFFCPNCGYHRPE
LTYSVDQIIDQTPNSLKFKMGEKEYSIGIGGTYNIYNALAAYSVAREFGLSEEEVAQSFA
ENKRIFGRQELINYAGKEIDLILVKNPVGLDEVLHMLNTEKDSYSLVTLLNANHADGIDT
SWIWDADYEGLNKDKIKKVLVGGRRWHDMGFRLEVSGFDPGLMTTVTNNDALLDEISKLP
TKKVYILATYTAMLSLRKTMGEKKIIKAGM

KEGG   T30595 (Metagenome): 909
Entry
909               CDS       T30595                                 

Gene name
murE2
Definition
mur ligase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Best hit
ljo:LJ_0928 (best score: 270.396)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.909-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_152:1412..1993
AA seq 194 aa
MFIKTNLAKFLGKVSYLVLHNIFNGGTSFPGKLAVKIDHNILEELASDYEVILVTGTNGK
TMTTSIITEALKEKYGDVLTNPSGSNMLQGIITAFLAHRKKHSQRKIAVLEVDEAYLKII
TTYLKPKVVVLTNIFRDQMDRYGEIYTTYEKIITGIKNCPDATIVANGDASIFSSDDLTN
QKIFYGFDLNNSDQ

KEGG   T30595 (Metagenome): 2359
Entry
2359              CDS       T30595                                 

Definition
adenosylcobyric acid synthase (glutamine-hydrolyzing)
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Best hit
ljo:LJ_0514 (best score: 466.077)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.2359-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_620:complement(13759..14442)
AA seq 227 aa
MADKTIKIAYLYEDLMNTYGDSGDVKVIRYLLDKQGYQTEVDNISLDDKFDANDYDFLFF
GGGQDFEQTVVAKDLPRHKETIENYINAGNPMLCICGGYQLMGDYYKTNSGITIKGLGIL
PLHTVFKADKRMIGDTRYMTEWGEVKAFENHSGQTYFDNTDMLHPFGEMIEGYGNNPQDK
VEGLRYKNFIGSYSHGPLLRNTNVANAIVKMILERHKERTANEVESV

KEGG   T30595 (Metagenome): 6306
Entry
6306              CDS       T30595                                 

Definition
adenosylcobyric acid synthase (glutamine-hydrolyzing)
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Best hit
ljo:LJ_0514 (best score: 395.586)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.6306-T1-C
LinkDB
Position
C128227:complement(1756..2442)
AA seq 228 aa
MTDKLIKIAYLYEDLMNTYGDSGDVKILRFLLKRQGYDTQVDNISLGDEFNAFDYDFVFF
GGGQDFEQTVVAKDIPRHKDTLEKYINAGHPMLCICGGYQFMGDYYKTNSGVTIKGLGIF
PLHTVFKSDKRMIGDTKYMTEWGEVVAFENHSGQTYFDNTDKLHPLGRMIEGYGNNPQDK
AEGLRYRNFIGSYSHGPLLKNVNVANAIVEMILTWHQKRLANQENVTE

KEGG   T30595 (Metagenome): 1732
Entry
1732              CDS       T30595                                 

Definition
cobB/cobQ-like protein
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Best hit
ljo:LJ_0514 (best score: 341.273)
Taxonomy
Firmicutes - Bacilli [GN:ljo]
Pathway
00550  Peptidoglycan biosynthesis
01100  Metabolic pathways
Other DBs
HMP: SRS047335.1732-T1-C
LinkDB
Position
SRS047335_WUGC_scaffold_479:complement(631..1257)
AA seq 208 aa
MNTYGDSGDVKIIKFLLKKAGYETEVDNVSLGTNFDASKYDFVFFGGGQDLEQTVVAKDL
PRHKQTLQKYIESGNPMLCICGGYQLLGSYYKTNAGITIKGLDIVPIHTVFKADKRMIGD
THYITQWGEVKAFENHSGQTYFDNDKLKPLGKMIEGYGNNPQDGVEGMRYKNLIGSYSHG
PLLKNENIANALVDKIITRYHRRTEHAL

DBGET integrated database retrieval system