KEGG   Amycolatopsis albispora: A4R43_03220
Entry
A4R43_03220       CDS       T05547                                 

Definition
(GenBank) non-ribosomal peptide synthetase
  KO
K12743  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase [EC:6.3.2.26]
Organism
aab  Amycolatopsis albispora
Pathway
aab00311  Penicillin and cephalosporin biosynthesis
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
Module
aab_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    A4R43_03220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aab01008]
    A4R43_03220
Enzymes [BR:aab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.26  N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase
     A4R43_03220
Polyketide biosynthesis proteins [BR:aab01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   A4R43_03220
SSDB
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Thioesterase
Other DBs
NCBI-ProteinID: AXB41650
UniProt: A0A344L0S6
LinkDB
Position
647054..657946
AA seq 3630 aa
MTSAKHLKTAADWCERIAAIAGQRCDLEMLLKDQWRHRVAVRDDDPAVRASQRQELVFAG
QDYTALKEAVDGGASLGAYALATLHSVLHAYGHGHQTVVAFLQHDRVLPVLVDHLAQGGL
SCATAVERIDEAVRRPDNYLARPELLQRGLFDALLVLTDRPLTLAELPPSPLVVIVRDDP
AARCLRWTLAYAGELFEDKIIAGVLDVAREVLGQFARRPEQLVADLDLVSADQELRLHQW
NGTDGEFDEEHRLNELFEDVVRRAPDREAVVCGDLSLTYREINERANRFAHWLLEVPVRR
GDLIGLYLDKSDLGVVATFGIWKAGAAYVPIDPGYPAERIRFIAGDTGLSGIVTNRRHAA
RLREVLAAEHPSVRVIEIETVLAERQPEAARENPRLELSSQDRAYVTYTSGTTGVPKGVP
KYHYSVVNSITDLSERYDMRRAGTERVALFASYVFEPHLRQTLIALLNEQTLVIVPDDVR
LDPDRFPSYIERHGVTYLNATGSVLQHFDLRRCPSLRKLLLVGEELTAAGLRQLREKYSG
HVVNEYAFTEAAFVTATKEFAPGVTERRDRSIGRPLRNVKWYVLSQDLKQLPIGAIGELY
IGGCGVAPGYLNRDDLTAERFTANPFQTEEEKARGRNGRLYRTGDLARVLLNGEVEFMGR
ADFQLKLNGVRVEPGEIEAQATEFPGVRKCVVVAKETAAGGRHLVGYYVPEESARVAEDE
LLAFLEQRLIRIMVPARMVPLSSIPVNVNGKVDWRALPDVRIDQPEHAPADGVTGRLREI
WSEVLGVPAGRIGDHDDFFRLGGQSILCILLIARVRQRLGRSLGVEDVFSLRTLGALAGY
LEQQAQDAEAASVADEVTTGGAPVRLLANGLQQGLLYHHLKTAGGDDAYVVQSVHHYHAP
IRPELMKDAWQHARRKYPALRLRFAWGDDPVQIVDNDDKPVDWRFADLSEVSDAEARIRE
LQERDRTEPYELAGGRLFRVYLIKQREDLFTLIFSCHHIILDGWSLPVLHDEVHRAYLAL
CTGAPLESEVDKAYVAAQRYWEAHRDDHTAYWAERIARIDERGDLAGLLNERSRYRVSLA
DYDHVREHRTRKLCLGAGLTAALKAGCAADQVTLHSVLQFVWHQVLHAIGGGTTTVVGTI
VSGRNLPVDGIEHSAGLFINTLPLIVDHREQAGRSVAEAVREIQATVNTMNGKSVVELGR
LHSGELKRRLFDTLLVLENYPRLLDEAEERAHQEQLRFEKAYDADKVDYPIAVVAREEGD
ELTVTLWYAGELFDEDTIDTLLEVARTLFRQVAEDISRPVRELELVSPEMLARFDSWNET
DEEFPADKTLHAVFEEMAARWPDEIAVVYRENRLTYRELNERANRLAHYLRSVAELRPDD
LVALMVDKSELMIVAIIAAWKTGAAYVPIDSGYPDDRISFMLADTAARLVVTNEIHSERL
RALPGAETRHVLEIELLHLGDQPAENPVTQTTSTDLAYAIYTSGTTGKPKAVLVEHRGVV
NLQVSLAKLFGLAKERGDEALLSFSNYIFDHFVEQMTDALLNGQKLVVLDDTMRTEPERL
YRYLNDERVTYLSGTPSVLSLYDYSTATTLTRIDAIGEDFTEPVFGKIRGTFGGLIINGY
GPTEVSITSHKRPYPPDVPRVNKSIGFPVANTRCYVLNEAMKRVPVGGIGELYLGGIGVA
RGYLNREDLTAERFLDNPFQTPEERRRGENGRLYKTGDLVRWLPNGEVEYLGRTDLQVKI
RGQRVELGEVEAALSSYPGVVRSLVVAREHTPGQKYLVGFYVGDQEFDEPDLKQWMRRQL
PESVVPARVLRITDIPVTPSGKLDTRRLPETDFGAGEGAEYVAPVSECELKLCGIWAQVL
GIAPDRIGAHDDFFALGGDSIRAMALAQAITTGFGQGLGVATVLQHTTLAAQAEHIQAAA
LEQAWTPLPAAAEHPPVSLAQERLLFIDDFEGGTAAYNIPFALRLPVTDRDVVAGALRTL
VGRHPALRTLLKSDGHGVRRQFTVPADQAAPRLEVTTVDSVAKLDEVLVEHAAHVFRLHE
ELPIRAELVEHGDECYLSVVVHHTCFDGWSWDIFRRELAALLDGVPEAELGSLRGTYAEF
AVWQRQYLTGGRLSALTAFWTDALAGFETINLPLDHPRPPRFDYRGRELEFQVDERTTEA
LRELARTTRVSLYSVLLGAWCVVLNLYTGQHDLVVGTPSANRGRPEFDRTIGFFANLLAL
RVRVDPAATVPAYVRSVGEVVVAAQVHGELPFEQLVKELAVEQDPSRHPVLQVNFTVQNV
SDHTSALTEYKPDADGWTTTKFDLSATLTETATGLAGNLTYAASLFEDSSAGGIIATFEH
VLAEFAASAADTPVARLSAVGEPEQDALLRPAAEPPVQRTRTLHAVFEEVAATWPDEIAV
VHGATRLSYRELNERANRLAHHLRSAGGLRPDDLVGLVLDQTELTVVAILAVWKAGAAYV
PVDPGYPDDRISFMLADTGAKLVLAGEAHGSRVRGLTAAKVLDLELLDLAGESAENPVTE
TTGTELAYAIYTSGTTGRPKAVLVSHGSADSFRAQLSGRYFGTPDEQREAVLFLSNYVFD
FSVEQLALSVLAGHKLIVPPPSAAGDPEFYALANREGLSYLSGTPTQVQRFDLARLTHLR
CVLVAGEAFRPQHFDKIRGEFGGPILNAYGTTETTVYNTVHRFEPGEPHRNTLGAPLGNT
RLYVLGDGMKLLPAGAVGELYLGGECVTEGYLHRPELTAERFVPNPFPAEAARYPMLYRT
GDVVRRGQDGELRYLGRNDAQVKINGLRIEPGEVEAVLASCPGVRQCAVVAGADPLAPER
TRLVGYYLPEPGTAVNENDLFDALRGRLMPSMVPSLLVRLDRPLPMTITGKLDVAALPSA
DFTPKRAAYAAPRDRVEARLCQLWSEHLPGGSAGIDDDYFRSGGDSISALRLAAQVQREF
ERKISVKHLFDHPTVRQFAANVLSGLEDGPPSGEEAEQGRLTGDCPLLPIQEWFFAKPLP
EPHRWNHNFAIRTPALDPGRLRAALDRLTDHHDAFRLRFPEPGKQVYADNAPPVTLHELD
VRQADVRQRLIDWQSEFDLAHGPTAVVAYLHGFDDGSARVWFAMHHLVVDTVSWRILAQD
LEILYNGGDLGAKSGSYRQWARAVREYAPDDEERRFWAETTRDMEPAEALTRTDSTRRRE
EFALTAEHTATLLTDSPWAYDTEVNDLLLTATGFALRSITRQATNHVTVEGHGRELFDGA
PDVRDTVGWFTTMHPFAVEVDPGDLGRSILTTKANRRRVPHHGIGYGALSGGRAPLPVVS
FNYLGRLGTAVTETMEPVEAWHLDPAMSGSHTTDRNRAANPAGIDVTMSCVGGRLTAVVD
SLLGEAATRLFASELKVWLERLITHTATRARNEPARATEPFDPYILVNEEAERTLFVLPP
GEGGAESYLSNLARQLTDHRLVLFNNVHLHTPMGSFEELGRYYTEHLRRLQPSGPYHLLG
WSFGGVLSLEIARRLARAGERIASLLLIDPYFGMRQASASIGLPEVEDILDPINYHYQPD
EADLARLADRLGEVVLFQAGELNDVVNGPHQPRLFEFYQRTRHNNLDLLLPAERIEVEVL
AGETHHSWVRNEELVKAMCERISTSTGRSS
NT seq 10893 nt   +upstreamnt  +downstreamnt
atgacgtcggcaaaacacctgaagaccgccgcggactggtgcgagcgcatcgccgcgatc
gccggtcagcgctgcgacctggagatgttgctcaaggaccagtggcggcaccgggtcgcc
gtccgcgacgacgacccggcggtccgggcctcccagcgccaggaactggtttttgccggc
caggactacaccgcgctgaaggaggcggtggacggcggtgcttccctcggcgcgtacgcg
ctcgccacgctgcacagcgtgctgcacgcctacgggcacgggcaccagaccgtggtcgcc
ttcctccagcacgaccgggtgctcccggtgctcgtcgaccacctcgcgcagggcgggctg
agctgcgccaccgcggtcgagcggatcgacgaagcggtgcggcggccggacaactacctg
gcgcggccggagttgttgcagcgcgggctgttcgacgcgctgctcgtgctcaccgaccgg
ccgctcaccctggctgaactgccgccgtcgccgctggtggtgatcgtgcgggacgacccg
gcggcacgctgcctgcgctggacgctggcctacgccggggagctgttcgaggacaagatc
atcgcgggcgtgctcgacgtcgcgcgggaggtgctcggccagttcgcgcgccgacccgaa
cagctcgtcgccgatctcgacctggtgtcggcggaccaggaactgcggctgcaccagtgg
aacggcaccgacggcgagttcgacgaggagcaccggctcaacgagctgttcgaagatgtg
gtgcggcgtgcgccggaccgtgaggcggtggtctgcggtgacctcagcctgacctatcgc
gagatcaacgagcgggccaaccggttcgcgcactggctgctcgaggtgccggtgcggcgc
ggggacctgatcgggctctacctcgacaagagcgacctcggcgtggtggccaccttcggc
atctggaaggcgggcgcggcctacgtgccgatcgacccgggttatccggccgagcgcatc
cgcttcatcgccggtgacaccgggctgtccggcatcgtgacgaaccggcggcacgcggcg
cgcctgcgcgaagtcctcgccgccgagcacccgtcggtgcgggtcatcgaaatcgaaacg
gtgctggccgagcggcagccggaggccgcgcgcgagaacccgcgcctggagctgagcagc
caggaccgcgcgtacgtcacctacacctcgggcaccaccggggtgcccaagggcgtgccg
aagtaccactacagcgtggtcaacagcatcaccgacctctccgagcgctacgacatgcgg
cgcgccggcaccgaacgcgtcgcgctcttcgcctcctacgtgttcgagccgcacctgcgc
cagacgctgatcgcgttgctcaacgagcagaccctggtgatcgtgcccgacgacgtgcgc
ctcgaccccgaccgcttcccctcctacatcgagcgccacggcgtcacctatctcaacgcc
accgggtccgtgctccagcacttcgacctgcggcgctgcccgagcctgcgcaagctgctg
ctggtcggcgaggaactgaccgcggcgggcctgcggcagctgcgtgagaagtactccggg
cacgtggtcaacgaatacgccttcaccgaggccgcctttgtcaccgccaccaaggagttc
gcgccgggcgtgaccgagcgccgcgaccgcagcatcggcaggccgctgcgcaacgtcaag
tggtacgtgctcagccaggacctcaaacagttgccgatcggcgcgatcggagagctgtac
atcggcggctgcggggtcgcgcccggatacctcaaccgggacgacctgaccgccgagcgc
ttcaccgcgaacccgttccagaccgaggaggagaaggcacgcggccgcaacggcaggctc
taccggaccggcgacctcgcgcgggtgctgctcaacggcgaggtcgagttcatgggccgc
gccgacttccagctgaagctgaacggcgtccgcgtggagccgggggagatcgaggcgcag
gccaccgaattccccggggtgcgcaagtgcgtggtggtggcgaaggagaccgccgccggt
ggccgtcacctcgtcggttactacgttcccgaggaatcggcgcgggtcgccgaagacgag
ctgctggccttcctcgaacaacggctcatccggatcatggtcccggcgcggatggtgccg
ttgtccagcattccggtcaacgtcaacggcaaggtggactggcgtgcgctgcccgacgtg
cgcatcgaccagcctgagcacgcgcccgcggacggcgtgaccgggcggttgcgggagatc
tggagcgaggtgctcggggtgcccgccggccggatcggtgaccacgacgacttcttccgg
ctcggcggccagagcattctgtgcatcctgctgatcgccagggtgcggcagcggctcggc
cggtccctcggcgtggaggacgtgttctccctgcgcacgctgggcgcgctggccgggtac
ctggaacagcaggcacaagacgccgaagcggcgtcggtggccgacgaggtcaccaccggt
ggcgcgccggtccgcctgctcgccaacggcctgcagcagggcctgctctaccaccacctg
aaaaccgcgggcggcgacgacgcgtacgtcgtgcagtcggtgcaccactaccacgcaccc
atccggccggagctgatgaaggacgcgtggcagcacgccaggcggaagtacccggcactg
cggttgcgcttcgcatggggcgacgaccccgtccagatcgtcgacaacgatgacaagccg
gtcgactggcgcttcgccgacctgagcgaggtcagtgacgccgaagcgcggatccgcgag
ttgcaggaacgcgaccgcaccgagccctacgaactggccggcggcaggctgttccgcgtc
tacctgatcaagcagcgcgaggacctgttcacgctgatcttcagctgtcaccacatcatc
ctggacggctggagcctgccggtcctgcacgacgaggtgcaccgggcctacctcgccctg
tgcaccggcgcgccgctcgagtccgaagtggacaaagcgtacgtggcggcgcagcggtac
tgggaagcgcaccgcgacgaccacaccgcctactgggccgagcggatcgcccggatagac
gagcgcggtgatctcgccgggctgctcaacgagcgcagccggtaccgggtctcgctcgcc
gactacgaccacgtgcgggagcaccggaccaggaagctgtgcctcggcgcgggcctcacc
gccgcgctcaaggcgggctgcgccgccgaccaggtgaccctgcactcggtgctgcagttc
gtctggcaccaggtgctccacgccatcggcggcggcaccaccaccgtggtcggcaccatc
gtttccggccgcaacctgccggtggacggcatcgagcactcggcaggcctgttcatcaac
acgctgccgctgatcgtggaccaccgggagcaggccggccgcagcgtcgccgaggcggtc
cgcgaaatccaggccacggtgaacacgatgaacggcaagagcgtggtggaactgggcagg
ctgcacagcggtgagctcaagcgccgcctgttcgacacgctgctggtgctggagaactac
ccgcgcctgctggacgaggccgaggaacgggcgcaccaggaacaactgcggttcgaaaag
gcctatgacgccgacaaggtggactacccgatcgccgtggtggcacgggaagaaggcgac
gagctgaccgtcaccctgtggtacgcgggtgagctgttcgacgaagacaccatcgacacc
ctgctcgaggttgcgcggacgttgttccgccaggtggccgaggacatctcgcggccggtc
cgcgaactggagctggtttcgccggaaatgctggcgcggttcgattcctggaacgagacc
gacgaagagtttccggcggacaagacgctgcacgcggtgttcgaggagatggccgcgcgc
tggccggacgaaatcgcggtggtgtaccgggaaaaccggctgacctaccgtgagctgaac
gagcgggccaaccggctggcgcactacctgcgctcggtggccgaactgcggccggacgac
ctcgtcgcgctgatggtggacaagagcgaactgatgatcgtggcgatcatcgccgcgtgg
aaaaccggcgcggcctacgtgccgatcgactccggttatccggacgaccggatctcgttc
atgctggcggacaccgccgcgcgcctggtggtgaccaacgagatccacagcgaacggctg
cgcgcgctgcccggcgcggaaacccggcacgtactggaaatcgagctgctgcacctcggc
gaccagccggcggagaacccggtcacgcagaccaccagcaccgatctcgcctacgccatc
tacacctcgggcaccaccggcaagcccaaggcggtgttggtcgaacaccgcggcgtggtc
aatctccaggtgtcgctggcgaagttgttcgggctggccaaggaacgcggggacgaggcg
ttgctgtcgttctcgaactacatcttcgaccacttcgtagagcagatgaccgacgcgctg
ctcaacgggcagaagctggtggtgctggacgacaccatgcgcaccgaacccgagcgcctg
taccggtacctgaacgacgagcgggtcacctacctgtccggcacgccgtcggtgctgtcg
ctgtacgactactcgacggcgaccacgctcacccggatcgacgccatcggcgaggacttc
accgagccggtgttcggcaagatccgcggcaccttcggcgggctgatcatcaacgggtac
gggcccaccgaggtgtcgatcaccagccacaagcggccctacccgccggacgtgccgcgg
gtgaacaagagcatcggtttcccggtcgccaacacccggtgctatgtgctgaacgaggcg
atgaagcgggtgccggtcggcgggatcggcgagctgtacctcggcgggatcggcgtggca
cggggttatctcaaccgcgaggacctgaccgccgagcggttcctggacaacccgttccag
accccggaggagcggcggcgcggggagaacggccgcctctacaaaaccggcgacctggtg
cgctggctgcccaacggcgaggtggagtacctcggccgcaccgatctccaggtgaagatc
cgcggccagcgcgtggaactcggcgaggtggaggcggcgctgtcgtcctatccgggcgtg
gtgcggtcgctggtggtggcgcgtgagcacacgccggggcagaagtacctcgtcggtttc
tacgtcggcgaccaggagttcgacgagccggacctcaagcagtggatgcgccggcagctg
cccgaatcggtggtgccggcgcgggtcctgcggatcaccgacatcccggtgacgccgagc
gggaagctggacacccggcggctgccggaaaccgacttcggggcgggcgagggcgccgag
tacgtcgcgccggtcagcgagtgcgagctgaagctgtgcggcatctgggcccaggtgctg
ggcatcgcgccggaccgcatcggcgcgcacgacgacttcttcgcgctcggcggggacagc
attcgcgcgatggcgctggcgcaggcgatcaccaccggcttcggccaggggctgggcgtg
gcgacggtgctccagcacaccacgctcgccgcgcaggccgagcacatccaggctgccgcg
ctcgagcaggcgtggacgccgctgcccgcggccgccgagcacccgccggtctcgctcgcg
caggaacgcctgctgttcatcgatgacttcgaaggcggtaccgccgcctacaacatcccg
ttcgcgctccggctgccggtgaccgaccgggacgtggtcgcgggcgcgctgcgcacgctc
gtcggacggcacccggcgttgcgcacgctgctcaagtccgacggccacggggtgcggcgg
cagttcaccgttccggcggaccaggccgcaccccggctcgaagtgaccacagtggacagt
gtggcgaagctggacgaagtgctcgtcgagcacgccgcccacgtgttccgcctgcacgag
gaactgcccatccgcgccgagctggtcgagcacggcgacgagtgctacctgagcgtcgtg
gtgcaccacacctgcttcgacggctggtcgtgggacatcttccgccgggagctggcggcc
ctgctcgacggcgtgcccgaagccgaactcggctcgcttcgcggtacctacgctgagttc
gcggtgtggcaacggcagtacctgaccggcgggcggttgtccgcgctcaccgcgttctgg
acggacgcgctcgccgggttcgagacgatcaacctgccgctggaccacccgcgcccgccg
cgcttcgactaccgcggccgcgagctggagttccaggtggacgagcggaccaccgaagcg
ctgcgcgaactggccaggaccaccagggtgagcctgtacagcgtgctgctcggtgcgtgg
tgcgtggtgctcaacctgtacaccgggcagcacgatctggtggtcggcacgccgtcggcg
aaccgcgggcgcccggagttcgaccgcaccatcggcttcttcgcgaacctgctggccttg
cgggtccgcgtggacccggcggcgaccgtgcccgcgtacgtgcgctcggtcggtgaggtc
gtggtcgccgcccaggtgcacggcgaactgccgttcgagcagctggtcaaggagctggcg
gtggagcaggatccgagccgtcatccggtgctgcaggtcaacttcaccgtgcagaacgtc
tccgatcacacgagcgcgctgaccgagtacaagccggacgccgatggctggaccaccacc
aagttcgacctgtcggccacgctgaccgagaccgcgaccgggctcgcgggcaatctgacc
tacgccgcctcgctgttcgaagacagcagcgccggcggcatcatcgccaccttcgagcac
gtgctggccgagttcgccgcgtcggcggccgacaccccggtcgcccggctcagcgcggtc
ggcgagccggagcaggacgcgctgctgcggcccgcggccgagccgccggtccagcggacc
cggacgctgcacgcggtgttcgaggaggtggccgcgacctggccggatgagatcgccgtg
gtccacggcgccacccggctgagctaccgcgagctgaacgagcgggccaaccggctcgcg
caccacctgcggtcggcgggcgggctgcggcccgacgacctggtcgggctggtgctggac
cagaccgagctgaccgtcgtcgcgatcctcgcggtgtggaaggccggtgcggcctacgtg
ccggtcgacccgggctatccggacgaccggatctcgttcatgctcgcggacaccggcgcg
aagctggtgctcgccggcgaagcccacggttcgcgggtgcgcggcctgaccgcggcgaag
gtgctcgacctcgaactgctcgacctggccggtgagtccgccgaaaacccggtcaccgag
accaccggcaccgagctggcctacgcgatctacacctcgggcaccaccggcaggcccaag
gcggtgctcgtctcgcacggttcggccgacagcttccgcgcgcagctgagtgggcgctac
ttcggcacgccggacgagcagcgcgaagccgtgttgttcctgtcgaactacgtgttcgac
ttctccgtcgagcaactcgcgctgtccgtgctcgccgggcacaagctgatcgtgccgccg
ccgtcggccgccggtgatccggagttctacgcgctggcgaaccgcgagggcctgagctac
ctcagcggcaccccgacccaggtgcagcgcttcgacctggcccggctgacgcacctgcgc
tgcgtgctggtcgccggggaggcgttccggccgcagcacttcgacaagatccgcggtgag
ttcggcggcccgatcctcaacgcctacggcaccaccgaaaccaccgtgtacaacaccgtg
caccgcttcgaacccggcgagccccaccggaacacgctcggcgcgccgctcggcaacaca
cggctgtacgtgctgggtgacgggatgaagctgctgcccgcgggcgcggtcggtgagctg
tacctgggcggcgaatgcgtcaccgaggggtacctgcaccggcccgagctgaccgccgag
cggttcgtgccgaatccgttcccggccgaggccgcccggtacccgatgctctaccggacc
ggcgacgtggtccggcgcgggcaggacggcgaactgcggtacctgggccgcaacgacgcc
caggtgaagatcaacgggctgcggatcgaaccgggcgaggtcgaagcggtgctggcgagt
tgtcccggcgtgcgccagtgcgcggtggtcgccggggcggacccgctggcgcccgagcgc
acccgcctggtcggctactacctgcccgagcccggcacggcggtcaacgagaacgacctg
ttcgacgcgctgcgcgggcggctgatgccgagcatggtgccgtcactgctggtccggctc
gaccgcccgctgccgatgacgatcaccggcaagctggacgtggccgcgttgcccagcgcg
gacttcacgccgaagcgcgcggcctacgcggcacctcgcgaccgcgtcgaagcacggctg
tgccagctgtggagcgagcacctgccgggtggttcggccggtatcgacgacgactacttc
cgctcgggcggggacagcatcagcgcgctgcggctggccgcccaggtgcagcgggagttc
gagcgcaagatcagcgtcaagcacctcttcgaccacccgaccgtgcggcagttcgcggcc
aacgtgctttccgggctggaggacggcccgccgagtggcgaggaagccgagcagggccgg
ttgaccggtgactgcccgctgctgcccatccaggagtggttcttcgccaagccgctgccc
gaaccgcaccggtggaaccacaacttcgcgatccgcacgccggcgctggaccccgggcgg
ctgcgtgccgcactggaccggctgaccgaccaccacgacgccttccggctgcggtttccc
gagccgggcaagcaggtctacgccgacaacgccccgccggtgacgttgcacgaactcgac
gtgcggcaggccgatgtccggcagcggctgatcgactggcagagcgagttcgacctggcg
cacgggcccacggcggtcgtggcctacctgcacggtttcgacgacggcagcgcgcgggtc
tggttcgcgatgcaccacctcgtggtcgacacggtcagctggcgcatcctcgcccaggac
ctggagatcctgtacaacggcggcgacctgggcgcgaagtccggcagttaccggcagtgg
gcgcgggcggtgcgcgagtacgccccggacgacgaggaacgccggttctgggcggaaacc
acgcgggacatggagcccgcggaggcgctgacgcggacggacagcacccggcgccgcgag
gagttcgcgctcaccgccgagcacaccgcgaccctgctcacggacagcccgtgggcctac
gacaccgaggtcaacgacctgctgctgaccgcgaccgggttcgcgttgcggtccatcacc
cgccaggccaccaaccacgtcaccgtcgaagggcacggccgcgaactgttcgacggcgcg
ccggacgtgcgtgacaccgtcggctggttcaccaccatgcaccccttcgccgtcgaagtg
gatcccggcgacctcgggcgcagcattctcaccaccaaggcgaaccggcggcgcgttccg
caccacggcatcggctacggcgccctgtccggtggccgggcgccgcttccggtggtcagc
ttcaactacctcggccggctcgggaccgcggtgacagagacgatggagccggtcgaggcg
tggcacctcgacccggcgatgtcgggtagccacaccacggatcgcaaccgcgcggcgaac
ccggccggcatcgacgtgacgatgagctgcgtcggcggacggctcaccgcggtggtggac
agcctgctcggcgaagcggccacccgcctgttcgccagcgagctgaaggtgtggctggaa
cggctgatcacccacaccgcgacccgcgcccgcaacgaacccgcccgtgccaccgaaccg
ttcgatccgtacatcctggtcaacgaggaagccgagcggacgttgttcgtgctgccgccg
ggggaaggtggcgcggagagctacctgagcaatctcgcgcggcagctgacggaccaccgg
ctggtgttgttcaacaacgtgcacctgcacacgcccatgggttcgttcgaggaactgggc
cgctactacaccgagcacctgcggcggttgcagccgtccgggccgtaccacctgctcggc
tggagcttcggcggcgtgctgtcgctggagatcgcccggcggctcgcgcgggcgggggag
cggatcgccagcctgctgctgatcgacccgtacttcggcatgcggcaggcctcggcgagc
atcggcctgcccgaggtcgaggacattctcgacccgatcaactaccactaccagccggac
gaagcggatctcgcgcggctcgccgaccggctcggggaggtggtgctgttccaggctggc
gagctgaacgacgtggtgaacggcccgcaccagccgcggttgttcgagttctaccagcgc
acgcgccacaacaatctcgacctcctgctgcccgccgaacggatcgaggtcgaggtgctg
gcgggggagacccaccattcgtgggtgcgcaacgaggagctggtcaaggcgatgtgcgag
cggatttcgacgagcacagggagaagttcatga

DBGET integrated database retrieval system