KEGG   Amycolatopsis albispora: A4R43_03225
Entry
A4R43_03225       CDS       T05547                                 

Definition
(GenBank) penicillin synthase
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
aab  Amycolatopsis albispora
Pathway
aab00311  Penicillin and cephalosporin biosynthesis
aab01100  Metabolic pathways
aab01110  Biosynthesis of secondary metabolites
Module
aab_M00673  Cephamycin C biosynthesis, aminoadipate + cycteine + valine => cephamycin C
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    A4R43_03225
Enzymes [BR:aab01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     A4R43_03225
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Other DBs
NCBI-ProteinID: AXB41651
UniProt: A0A344L0S7
LinkDB
Position
657949..658926
AA seq 325 aa
MPSAEVPTIDVSPLFGTSAEEKMRVGQEINKACRGSGFFYAANHGVDVQQLQDVVNEFHR
TMTDQEKYDLAINAYNKNNPHVRNGYYMAIKGKKAVESFCYLNPSFSEDHPEIKAGTPMH
EVNIWPDEERHPRFRPFCEQYYWTMHRLSKTLMRGFALALGKPEEFFEPELKEQDTLSSV
SLIRYPYLEDYPPVKTGPDGMKLSFEDHFDVSMITVLFQTEVQNLQVETVDGWQDLPTSD
RHFLVNAGTYLAHLTHDYFPAPLHRVKFVNAERLSLPFFFHAGQHTLIEPFHPDGVPDGE
RNEAVRYGDYLNHGLHSLIVKNGQT
NT seq 978 nt   +upstreamnt  +downstreamnt
atgccgtcagcagaggtgccgaccatcgacgtctcgccgttgttcgggaccagcgccgag
gaaaagatgcgcgtcggccaggaaatcaacaaggcctgccgcggctcgggtttcttctac
gcggccaaccacggcgtcgacgtgcagcagttgcaggacgtggtgaacgaattccaccgg
acgatgaccgaccaggagaagtacgacctggccatcaacgcctacaacaagaacaacccg
cacgtgcgcaacggctactacatggcgatcaagggcaagaaggcggtcgagtccttctgc
tacctgaacccgtccttctccgaggaccacccggagatcaaggcgggcacgccgatgcac
gaggtgaacatctggccggacgaggaacggcacccgcggttccggccgttctgcgagcag
tactactggaccatgcaccggctgtccaagacgctgatgcgcggattcgcgctggcgctg
ggaaagccggaggagttcttcgagccggagctgaaagaacaggacacgctttcttcggtt
tcgctgatccggtacccgtacctggaggactacccgccggtgaaaaccgggcccgacggc
atgaagctgagcttcgaggaccacttcgacgtctcgatgatcaccgtgctgttccagacc
gaggtgcagaacctccaggtggaaaccgtggacggctggcaggacctgcccacctcggac
cgccacttcctggtcaacgccggcacctacctggcgcacctgacccacgactacttcccg
gccccgctgcaccgggtgaagttcgtcaacgcggaacgcctgtcgctgccgttcttcttc
cacgccgggcagcacacgctgatcgagcccttccaccccgacggcgtgccggacggcgag
cgcaacgaggccgtccggtacggcgactacctcaaccacggtctgcactcgctgatcgtg
aagaacgggcagacctga

DBGET integrated database retrieval system