KEGG   Amycolatopsis albispora: A4R43_34225
Entry
A4R43_34225       CDS       T05547                                 

Definition
(GenBank) amidase
  KO
K19795  ureidomalonase [EC:3.5.1.95]
Organism
aab  Amycolatopsis albispora
Pathway
aab00240  Pyrimidine metabolism
aab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A4R43_34225
Enzymes [BR:aab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.95  N-malonylurea hydrolase
     A4R43_34225
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: AXB46884
UniProt: A0A344LFR0
LinkDB
Position
complement(7293304..7294701)
AA seq 465 aa
MNLVELDAVELAERIRLREVSCTEVMAAYLDQIEQHNPRLNAIVALRDRDELMREAAERD
REPHRGWLHGFPLAVKDLSAAAGLPWTFGSPVFAEQVAQHDDLFVRRMKDAGAIVIGKTN
VPEFGLGSQTYNPVYGPTRNPLDPSRTPGGSSGGAAAAVAARMLPVADGSDYLGSLRNPA
AFTNIYGFRPSLGRVPSTSFVAQLDTAGPMGRTVADVAALLSVQAGPDPRAPLSLGDDPS
MFMPPFEPRDFAGTRIAWVGDFDGYLPMDPGVLDVCRDAFAGFTALGCEVVPAVPDYPMD
RVWRAVLTWRGFNVAANLGSLYRAPELRAQLKPELVWELEQGLGLSAADLGPASLERTRW
LEALLRFFEDYDFILAPSAQVFPFDVDVPWPKTVGGREMDTYHRWMETVAPWSLAGVPVL
GMPAGFTADGLPMGVQLIGKPRADLDVLHLAAAHETQRKLLRAKA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaacctggtcgaactcgacgcggtggagctggccgagcggatccggcttcgcgaggtg
tcgtgcaccgaggtgatggccgcgtacctggaccagatcgagcagcacaacccgcggctc
aatgcgatcgtcgcgttgcgtgaccgcgacgagctgatgcgggaggccgccgagcgggat
cgggagccgcaccgcggctggctgcacgggttcccgttggccgtgaaggacctctccgcc
gcggccggtctgccgtggaccttcgggtcgccggtgttcgccgagcaggtcgcccagcac
gacgacctcttcgtgcggcggatgaaggacgcgggcgcgatcgtcatcggcaagacgaac
gtgcccgaattcggcctcggctcgcagacgtacaacccggtctacggaccgacgcggaat
ccgctcgatccgtcgcgcacgccgggtggcagcagtggaggcgccgcggcggcggtcgcg
gcgcggatgctgccggtggccgacggcagcgattacctcggatcgctgcgcaatccggcg
gcgttcacgaacatctacgggttccggccgtcgctcgggcgcgtgccgtcgacctcgttc
gtggcgcagctggacacggccgggccgatgggacggacggtcgccgacgtcgcggcgctg
ctgtcggtgcaggccgggccggatccgcgggcgccgctgagcctcggcgacgacccgtcg
atgttcatgccgccgttcgagccgcgcgacttcgccggcacgcggatcgcgtgggtcggc
gatttcgacgggtacctgccgatggaccccggggtgctcgacgtgtgccgcgacgcgttc
gccgggttcaccgcgctcggctgcgaggtggtgcccgcggtgccggactacccgatggac
cgggtgtggcgggccgtgctgacctggcgcgggttcaacgtcgcggcgaacctcgggtcg
ctttaccgggcgccggagttgcgggcgcagttgaagccggagctggtgtgggaactcgag
cagggcctcggcctgtcggcggccgatctcgggccggcgtcgctggagcgcacgcggtgg
ctggaggcgctgctgcggttcttcgaggactacgacttcatcctggcgccgagcgcgcag
gtgttcccgttcgacgtggacgtgccgtggccgaagaccgtcgggggtcgtgagatggac
acgtaccaccggtggatggagacggtggcgccgtggtcgctggcgggcgtgccggtgctg
ggcatgccggccggcttcaccgccgacggcctgccgatgggcgtgcagctgatcggcaaa
ccccgcgccgacctggacgtcctccacctcgccgcagcccacgaaacccagcggaagctt
ttgcgggcaaaagcatga

DBGET integrated database retrieval system