KEGG   Apteryx mantelli mantelli (brown kiwi): 106493510
Entry
106493510         CDS       T04298                                 

Name
(RefSeq) glutathione S-transferase omega-like 3
  KO
K07393  glutathionyl-hydroquinone reductase [EC:1.8.5.7]
Organism
aam  Apteryx mantelli mantelli (brown kiwi)
Brite
KEGG Orthology (KO) [BR:aam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106493510
Enzymes [BR:aam01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.7  glutathionyl-hydroquinone reductase
     106493510
SSDB
Motif
Pfam: GST_C_2 GST_C GST_C_3
Other DBs
NCBI-GeneID: 106493510
NCBI-ProteinID: XP_013809030
LinkDB
Position
Un
AA seq 193 aa
IGIMNSAAFDEFVGEEYRQVRLVPRSLEAQITEFNSWVYDKINNGVYKAGFAECAEVYER
EVTSLFQYLDKLENLLDKKYTDLEAEYGKNNKDKILDRYFAIGDTLTEADVRLYPTIVRF
DVVYHQHFKCNLATIRDDYSRIHTWLKNIYWRHEAFQRTTDFTHIKLGYTRSQPRVNPIG
ITPLGPKPDIRPP
NT seq 582 nt   +upstreamnt  +downstreamnt
atcggaattatgaattccgctgcgtttgatgagtttgtcggcgaagaataccgtcaagtc
cgtctggtacctcggtctctagaggcacagattacagagttcaactcttgggtgtacgat
aaaatcaacaacggtgtatacaaggccggttttgcagaatgtgcagaggtatacgagagg
gaggtaacaagcctttttcaatatcttgacaaattggaaaatcttctggacaagaagtac
acagatttggaggcggagtatggtaagaacaacaaggacaagatactagatcgctacttt
gccatcggagacactctgaccgaggcggacgtgagactctacccaacgatagtaaggttc
gacgtggtataccatcaacacttcaaatgcaatctggccaccatcagagatgattattcc
cgtatacacacgtggctcaagaatatatactggcgccacgaagccttccagcgcacaacg
gactttacccacataaaactcggatatactcgctcgcagccacgggtcaacccgattggg
atcaccccactggggcccaagcctgatatccgacctccatga

DBGET integrated database retrieval system