Actinokineospora auranticolor: V5P93_006712 Help Entry V5P93_006712      CDS       T10991                                  Name (GenBank) hypothetical protein   KO K01849   methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2] Organism aaur  Actinokineospora auranticolor Pathway aaur00280   Valine, leucine and isoleucine degradation aaur00630   Glyoxylate and dicarboxylate metabolism aaur00640   Propanoate metabolism aaur00720   Other carbon fixation pathways aaur01100   Metabolic pathways aaur01120   Microbial metabolism in diverse environments aaur01200   Carbon metabolism Module aaur_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:aaur00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     V5P93_006712    00640 Propanoate metabolism     V5P93_006712   09102 Energy metabolism    00720 Other carbon fixation pathways     V5P93_006712   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     V5P93_006712 Enzymes [BR:aaur01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.2  methylmalonyl-CoA mutase      V5P93_006712 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  B12-binding Peripla_BP_6 Glyco_trans_4_4 GLUCM-like_C DUF7224 Glyco_transf_4 Fer2_4 DUF7126 Motif Other DBs NCBI-ProteinID:  XGP79128 LinkDB All DBs Position complement(7740884..7741138) Genome browser AA seq 84 aa AA seqDB search MRIVLTGADDLARALRDAGAEVVYLTDTDPARVAATAVQEDADAVVAATALPAITALLAD NGAEDIAVVAADGALAWLADTAGE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcgaatcgtcctcacgggtgccgacgacctcgcccgcgcactacgcgacgcgggggcg gaggtggtctacctgaccgacaccgacccggcccgtgtcgccgcgaccgcggtccaagag gacgccgacgcggtggtcgcggccaccgctctcccggcgatcaccgcgttgttggccgac aatggcgcggaggacatcgccgtggtcgccgccgacggggctctcgcctggctggccgac acggccggtgagtga

DBGET integrated database retrieval system