Aeromonas bestiarum: IU367_18855 Help Entry IU367_18855       CDS       T08822                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism abes  Aeromonas bestiarum Pathway abes02024   Quorum sensing abes03018   RNA degradation Brite KEGG Orthology (KO) [BR:abes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     IU367_18855 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     IU367_18855 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:abes03019]     IU367_18855 (hfq)    03036 Chromosome and associated proteins [BR:abes03036]     IU367_18855 (hfq) Messenger RNA biogenesis [BR:abes03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      IU367_18855 (hfq) Chromosome and associated proteins [BR:abes03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     IU367_18855 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Iec3-like_M Motif Other DBs NCBI-ProteinID:  WDL82110 LinkDB All DBs Position 4122455..4122817 Genome browser AA seq 120 aa AA seqDB search MTTESPSYSTIEQAFSLGNGQDSALNWLRKNRSQVAIFLVSGIKLEGTISGFDQYSVLLT DAHGNQQLVYKAKISTIAMHSGRPQVSIQRARKPRVSMAPRPHGAPGRYDDNQGGGSSEQ NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgacaactgaatccccaagctactccacgatcgagcaagccttctccctcgggaacggg caagattctgccctcaactggttgcgcaagaatcgcagtcaggttgccatcttcctggtg agcggcatcaagctggaggggaccatcagcggtttcgaccagtacagcgtgctgttgacc gatgcccatggcaaccagcagctggtctacaaggccaagatctccaccatcgccatgcac tccggccgtccccaggtcagcatacagcgtgcccgcaagccgcgcgtctccatggcgccg cgtccccatggcgcccccggtcgttacgatgacaatcagggcggcggtagcagcgagcag taa

DBGET integrated database retrieval system