KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT111721
Entry
AGABI1DRAFT111721 CDS       T03136                                 
Symbol
AGABI1DRAFT_111721
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Brite
KEGG Orthology (KO) [BR:abp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AGABI1DRAFT111721 (AGABI1DRAFT_111721)
Enzymes [BR:abp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     AGABI1DRAFT111721 (AGABI1DRAFT_111721)
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 18823391
NCBI-ProteinID: XP_007327061
JGI: Agabi_varbur_1_111721
UniProt: K5X5Z4
LinkDB
Position
Unknown
AA seq 481 aa
MPGKREEKSVRFSVMVGFISFVALAIALVAPAAAFPAHGSLAGLSRQELDDAMSSFGKYK
RPPPPPGPLEYGGVKLVNDAEHPFKPPRKGDIRGPCPALNTLANHGYISRNGIESPSNIV
RAAMEGFNMNNDLAKFTCYAAFIVNGNMVTDLVSIGEKSKKTGPDPKDQPATIGGLNTHN
VFEGDSSMTRADFYDGGDVESFNETLFQGFLEYSYRFGGGRYNLTAAGEYRLKRTQDGIQ
NNPTFTIVAPRLFSAYSESVNPINLWVDGRQDDGQLRLDHARSFFEAARYPDDFHRAARP
MSADNEAVVHAIHPLEPGANVAGVNTYTVDRNAPRLDDKCGIFEYHVNTTLRTLYPNPRG
NLLDAIRANIHYFYTSVQARGCTEIFPYGRFEDGKNNAYYAYPDFPEVDLPEYGTFPFPP
VELPPYSDDLVPTSTAPASSAAASSAPASSAAASPEASMAAPEASMAASEASMAVPEASS
A
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgccgggcaagagggaagaaaaatcagttcgcttttcagtcatggttggcttcatctcc
ttcgttgcgctcgcaatcgctttggtcgctcccgccgccgcattcccagcacatggttca
ttagctggattgtcgaggcaagaattggacgatgccatgagtagcttcggcaaatacaaa
agaccgccaccaccccctggacccctcgaatatggtggtgtcaagctcgtcaacgatgcc
gaacatcctttcaagcctccgcgcaaaggtgatatccgtggtccttgcccggctttgaac
actctcgccaaccatggttacatcagccgcaacggtattgagtcaccatctaacatcgtc
cgtgccgccatggaaggtttcaacatgaacaacgacttggccaagttcacctgctacgct
gccttcattgtcaacggaaacatggtcaccgacttggtcagtatcggtgaaaagtccaag
aagactggacccgacccgaaagatcaaccggcgactattggtggtttgaacacgcataac
gtgtttgagggtgacagctctatgactcgagctgatttctatgatggtggcgatgtcgag
agcttcaacgagaccctcttccaaggattccttgaatacagctacagattcggtggtgga
aggtacaaccttaccgctgctggcgagtaccgcctcaagcgtactcaagacggtatccaa
aacaatcccaccttcaccattgtcgctccccgactcttctctgcttactctgaatccgtc
aaccccatcaacttgtgggtagatggacgccaagacgatggacaactcaggctcgaccat
gcccgcagcttctttgaggccgcccgttatcccgatgacttccaccgagctgcacgcccc
atgagtgctgataacgaggccgtcgtgcatgctatccatccccttgagccaggagccaac
gtcgcaggagttaacacttacactgtggaccgtaatgcacccagacttgacgacaagtgc
ggtatcttcgagtaccacgtcaacaccactctgcgcacactctaccccaacccgagaggc
aacttgttggacgcgatcagggccaacatccattacttctacacctctgtccaagctaga
ggttgcaccgaaatcttcccctacggtcgattcgaggatgggaaaaacaatgcttactac
gcgtaccctgatttccccgaggtcgatcttcccgaatacggaactttccccttcccccca
gtagagctccctccctactctgacgacctcgtccccacatccaccgcccctgcatccagt
gctgccgcatccagtgcccccgcatccagcgccgcggcatcacctgaagcatcgatggcg
gctcctgaagcatcgatggcggcttctgaagcatcgatggcggttcctgaagcatctagc
gcctaa

DBGET integrated database retrieval system