KEGG   Agaricus bisporus var. burnettii JB137-S8: AGABI1DRAFT115045
Entry
AGABI1DRAFT115045 CDS       T03136                                 
Symbol
AGABI1DRAFT_115045
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
abp  Agaricus bisporus var. burnettii JB137-S8
Brite
KEGG Orthology (KO) [BR:abp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AGABI1DRAFT115045 (AGABI1DRAFT_115045)
Enzymes [BR:abp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     AGABI1DRAFT115045 (AGABI1DRAFT_115045)
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 18824575
NCBI-ProteinID: XP_007331632
JGI: Agabi_varbur_1_115045
UniProt: K5X3P2
LinkDB
Position
Unknown
AA seq 377 aa
MARFSSFIVLAIALVSSTTAFPAYQSLGGLSQRQIDSIMPGLKAVKPKDPPPPLKDNGTK
LVNDAKHPWKPLRDGDKRGPCPGLNTLASHGWLPRDGVATPQQIIAASQEGFNFESQIAR
RFTYSSHLIDGNLVTDLLSIGAKTDKTGPDPPAPANPGGLNLHGAIEGDASMTRGDAYWG
DNWHFNETQFSELLEFMDKYGDGLYNYKVAGEFRYQRIQESIATNPEFNFTGGRFFAAYI
ETVVGANLFSDGRRNDSQVPADAARGFFQDSRMPDDFHRAARPFSTEGVEVVIGAHPFSP
GRNVNGINTYTIDPNSPTFESDPDGCAQYEMFVNEAVVPLYPNPTGVLRRNLKINLQHYF
DTFGGKCKQLFPYGRDH
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggctcgcttttcatccttcattgtcctcgctattgctctggtttcttcgaccacggct
ttccctgcctatcaatcgctgggagggctgtcgcaaagacagatagattcaatcatgcct
ggccttaaagcagtcaagccaaaggacccgccacctcctttgaaggacaacggaactaaa
ctcgtcaatgatgccaaacatccttggaagcccctccgagacggcgataagcgagggcct
tgtcctggattgaacactcttgcttctcatggttggttgccgcgtgatggtgttgcaaca
ccacaacaaatcatcgctgcctcccaagaaggattcaatttcgagagtcagatcgcaagg
aggtttacatattccagtcatctcattgacggaaaccttgtcaccgatctgctcagcatt
ggcgcgaagactgataaaactggtcctgatccacccgccccagcaaaccccggtggcctc
aacttacatggagctattgaaggcgacgccagcatgacccgaggtgacgcgtactggggt
gacaattggcacttcaacgagacccagttctcagagctccttgaattcatggataaatac
ggagatggactctacaactacaaggtcgcaggtgaattcagatatcagcgtatccaagag
tccattgcgacgaacccggaatttaacttcaccggcggtcgcttctttgctgcatacatc
gaaacggtcgtaggagccaacttgttctctgatggacgccggaacgatagtcaagttccc
gccgacgctgcacgcggctttttccaagactcgcgtatgcctgatgacttccacagagcc
gccaggccgttcagcacagaaggtgttgaagttgtcattggtgcccaccccttctctccg
ggtcgtaacgtcaatggaatcaacacatacaccatcgatcccaattctcccactttcgag
tccgacccggatggctgtgcgcagtatgagatgtttgtgaatgaggccgtcgttcctttg
tatcccaacccgactggggtgctaaggaggaatttgaaaatcaacttacaacactacttt
gatacttttggtggtaaatgcaagcagctattcccttacggaagagatcattag

DBGET integrated database retrieval system