KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT183665
Entry
AGABI2DRAFT183665 CDS       T03140                                 
Symbol
AGABI2DRAFT_183665
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
abv  Agaricus bisporus var. bisporus H97
Brite
KEGG Orthology (KO) [BR:abv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AGABI2DRAFT183665 (AGABI2DRAFT_183665)
Enzymes [BR:abv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     AGABI2DRAFT183665 (AGABI2DRAFT_183665)
SSDB
Motif
Pfam: Peroxidase_2
Other DBs
NCBI-GeneID: 18080399
NCBI-ProteinID: XP_006458703
JGI: Agabi_varbisH97_2_183665
LinkDB
Position
Unknown
AA seq 373 aa
MFDLEYLVPLALAFSVPARAFPAHASLAGLRTEEWNKALATLKYTPPPPPPGPLECSGTK
LVNDADHPYMDPQPGDIRGPCSGLNTLASHGYINRTGITSCSEIITAAMEGFNMENNLAR
FTCYAAFLVDGNVITDKLSIGGKSDKTGPDPPGPATVAGLSTHNLFEGDTSMTRADAYFG
GDNNFNETLFQEFVEYSNRYGGGKYNLTVAGEYRFKRIQDSIATNPTFSFVAPRLFSAYS
ESVNPINFWVDGRQDDGQLDPEVARSFFEKMRFPDDFHRAARPMNGENELEVLAAHPIEP
GSNINGVDTYTPDPTSGKLADKCTLYENHVNRTVRSLYPDPTGDLLDALKINMHYFYTSV
QHRGCKEIFPYGQ
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgttcgacctcgaatatcttgtccctcttgcccttgcattttctgtccccgctagagcc
tttcctgcccatgcttctttagctggtttgcgtacagaagaatggaacaaagcactagct
actctaaagtatactcctccaccgccgccccctggccctttggaatgtagtggtaccaag
ctcgtcaatgatgctgatcatccttacatggatccacaaccgggcgacatacgcgggccc
tgctcaggtttgaacacgctcgcctcccatggatatataaatcgcaccggaattaccagt
tgttcagaaataatcactgcagcaatggaagggtttaatatggagaataacctcgcgaga
tttacgtgctacgctgccttcctcgtagacggcaatgttatcactgacaaactcagtatt
gggggaaagtctgataagactggtcctgatccacccggcccagctactgtagccggtctg
agcacgcacaatttatttgagggggataccagtatgactcgagcggatgcctactttggt
ggcgacaacaacttcaacgagacattattccaagagttcgttgaatacagcaaccggtat
ggtggtggaaaatacaatctcacagttgctggcgagtaccggtttaagcggattcaagat
tctattgccaccaatcccaccttcagcttcgtcgctccccgtctattttctgcatactcc
gaatccgtcaaccccatcaatttttgggtcgatggacgccaagacgatggtcaacttgac
cccgaagtcgctcgtagcttctttgagaagatgcgttttcctgacgactttcaccgagct
gcacgtccgatgaacggtgaaaatgagttagaggtgcttgctgcgcatccaattgaaccg
ggaagcaatatcaacggagttgatacttacactcccgatcctacatcaggaaaattggcg
gataaatgtacgttgtacgagaaccatgtgaatcgcactgtgagaagtttatacccggac
ccgactggcgacttgttggatgctcttaagattaacatgcactacttctatacatcggtg
cagcacagggggtgtaaagaaatattcccttatgggcagtga

DBGET integrated database retrieval system