KEGG   Acinetobacter oleivorans: AOLE_00010
Entry
AOLE_00010        CDS       T01263                                 
Name
(GenBank) DNA polymerase III, beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_00010
   03430 Mismatch repair
    AOLE_00010
   03440 Homologous recombination
    AOLE_00010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_00010
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_00010
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_00010
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_00010
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_00010
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3 YabP
Other DBs
NCBI-ProteinID: ADI88905
UniProt: D8JKL5
LinkDB
Position
1828..2976
AA seq 382 aa
MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTVLT
EGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQRCILKSGNSRFVLGTLPAEDYP
LLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLRAVTTDGHR
LALCEITASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTPSRDKE
QGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLISHDVFKQSLQRVAILSNEKLRGVFLN
FNQDSLQLRANNPEQDEAIEDLAIQYQNVPLEMSFNAQYLLEVLGVLDGDDVNMSMSEAN
QSVLVQDPAHTDQTYVVMPMRV
NT seq 1149 nt   +upstreamnt  +downstreamnt
gtgcgtttgaaaatcgctaaagaaagtttactcaatgttttatcgcatgttgtcggtgcg
gtagaacgtcgtcatacattgaatattctttcaaacgtcaaaattcagactaatgctcag
gcgctcaccattactggttccgatttagaggtcgaactggttgcgagcactgttttaaca
gaaggggcatgccttgaagcaggggaaaccacagtccctgcgcgtaaattaatggaaatt
tgtaaatcattgcctacagctgcattaattgatttacaaattactgaagatcaaagatgt
atcttaaaatctggtaatagccgtttcgtattaggaactttaccagcagaagattatcca
ttattgacgactgaaaatagtcaaggtactcaagtacaggtaactcaacgtgagttaaag
cgtttatttgaaaaaactgcttttgcgatggctgtacaagatgtacgtttctatttaaca
ggtactttattggaaattgatgaaaatcaattacgtgcagtaacaacagatggacaccgt
ttagcactttgtgaaattacggcttcttctacatcatctcaattggttcaggctattgta
cctcgtaaagctgttggtgaattacagcgcttattgagtattgaagatgaacaattaaca
ttgttgattggtcgtgagttgttaaatgtaaccatcaatacgccaagtcgtgacaaagag
cagggtgatattactgttcgttttacaacaaaattgatcgatggaaaattccctgattat
cgtcgtgtaattccacgtggtggcgataaacatgtattaattagccatgatgtatttaag
caatcattacaacgtgttgcaattttgagtaatgaaaaattgcgtggcgttttcttgaat
tttaatcaagattctttacagcttcgtgcgaataatcctgagcaagatgaggctattgaa
gatttagctatccaatatcaaaacgtaccgcttgaaatgtcatttaatgcgcaatattta
cttgaagtattgggtgtacttgatggcgatgacgtaaacatgagtatgagtgaagcgaat
cagtctgttttggtccaagacccagcacatactgatcaaacttatgtagttatgccgatg
cgtgtataa

DBGET integrated database retrieval system