KEGG   Acinetobacter oleivorans: AOLE_00010
Entry
AOLE_00010        CDS       T01263                                 
Name
(GenBank) DNA polymerase III, beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_00010
   03430 Mismatch repair
    AOLE_00010
   03440 Homologous recombination
    AOLE_00010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_00010
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_00010
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_00010
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_00010
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_00010
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3 YabP
Other DBs
NCBI-ProteinID: ADI88905
UniProt: D8JKL5
LinkDB
Position
1828..2976
AA seq 382 aa
MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTITGSDLEVELVASTVLT
EGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQRCILKSGNSRFVLGTLPAEDYP
LLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTLLEIDENQLRAVTTDGHR
LALCEITASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTPSRDKE
QGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLISHDVFKQSLQRVAILSNEKLRGVFLN
FNQDSLQLRANNPEQDEAIEDLAIQYQNVPLEMSFNAQYLLEVLGVLDGDDVNMSMSEAN
QSVLVQDPAHTDQTYVVMPMRV
NT seq 1149 nt   +upstreamnt  +downstreamnt
gtgcgtttgaaaatcgctaaagaaagtttactcaatgttttatcgcatgttgtcggtgcg
gtagaacgtcgtcatacattgaatattctttcaaacgtcaaaattcagactaatgctcag
gcgctcaccattactggttccgatttagaggtcgaactggttgcgagcactgttttaaca
gaaggggcatgccttgaagcaggggaaaccacagtccctgcgcgtaaattaatggaaatt
tgtaaatcattgcctacagctgcattaattgatttacaaattactgaagatcaaagatgt
atcttaaaatctggtaatagccgtttcgtattaggaactttaccagcagaagattatcca
ttattgacgactgaaaatagtcaaggtactcaagtacaggtaactcaacgtgagttaaag
cgtttatttgaaaaaactgcttttgcgatggctgtacaagatgtacgtttctatttaaca
ggtactttattggaaattgatgaaaatcaattacgtgcagtaacaacagatggacaccgt
ttagcactttgtgaaattacggcttcttctacatcatctcaattggttcaggctattgta
cctcgtaaagctgttggtgaattacagcgcttattgagtattgaagatgaacaattaaca
ttgttgattggtcgtgagttgttaaatgtaaccatcaatacgccaagtcgtgacaaagag
cagggtgatattactgttcgttttacaacaaaattgatcgatggaaaattccctgattat
cgtcgtgtaattccacgtggtggcgataaacatgtattaattagccatgatgtatttaag
caatcattacaacgtgttgcaattttgagtaatgaaaaattgcgtggcgttttcttgaat
tttaatcaagattctttacagcttcgtgcgaataatcctgagcaagatgaggctattgaa
gatttagctatccaatatcaaaacgtaccgcttgaaatgtcatttaatgcgcaatattta
cttgaagtattgggtgtacttgatggcgatgacgtaaacatgagtatgagtgaagcgaat
cagtctgttttggtccaagacccagcacatactgatcaaacttatgtagttatgccgatg
cgtgtataa

KEGG   Acinetobacter oleivorans: AOLE_06955
Entry
AOLE_06955        CDS       T01263                                 
Name
(GenBank) DNA polymerase III, tau and gamma subunits
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_06955
   03430 Mismatch repair
    AOLE_06955
   03440 Homologous recombination
    AOLE_06955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_06955
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_06955
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_06955
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_06955
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_06955
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA Trypan_PARP RuvB_N AAA_5 AAA_19 AAA_30 AAA_16 AAA_18 DNA_pol3_tau_5 AAA_22 AAA_14 TsaE Mg_chelatase TonB_N AAA_24 AAA_assoc_2 DNA_pol3_delta AAA_7 Rad17 SKI Herpes_Helicase AAA_28
Other DBs
NCBI-ProteinID: ADI90284
UniProt: D8JHB4
LinkDB
Position
1512688..1514841
AA seq 717 aa
MYQVLARKYRPRNFNELVGQNHVSRALSSALERGRLHHAYLFTGTRGVGKTTIARILAKC
LNCETGVTSTPCEVCATCKAVNEGRFIDLIEIDAASRTKVEDTRELLDNVPYAPTQGRFK
VYLIDEVHMLSTHSFNALLKTLEEPPEHVKFLFATTDPQKLPITVISRCLQFTLRPLAVD
EITRHLGAILEKEQINADQDAIWQIAESAQGSLRDALSLTDQAIAYGQGSVHHQDVKEML
GLIDRTIIYDLILAIHQNQREKVSQLLLQFRHQALDVSLVLDQLISTLHELAILQYLPDL
SLKYSDEINRKIMQLSKLISAQDLQLYYQIACKGRSDLQLAVTQEQGFEMCVLRLLAFRP
LAPNEILVSEPVQQNGQAVMNHQVQQQVQDIAPVSAVQPVEVISQPVMVEPEPEPEPEPE
PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPQSNQDLMVFDPNHHELIGLESAVVHET
VSVLEEDFIPLPEQKFVQVQAETQAKQIEPESAFSAEPQGLFETSSAEFSLDQDAPITPD
LSSEPVIEQQSFVQAEVMVQTETVAVVKESSETDNGQLMPQDILKLAPQVLEGEWSLEKW
EYWFRNSQLSPAVQELAQHGVMTGEIGGNTIFHIPQEYENMLTQLQQGLIDALNEQWPNT
QFTVEYGALNTSTPYTIQSARKEKAFHRAAELLQQQPVIKSLIETFDGELQNIQLKP
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgtatcaagtacttgctagaaaataccgtccacgtaatttcaatgagttagtggggcaa
aaccatgtttctcgtgcattaagtagtgcattggaacgcggtcgtctgcaccatgcttat
ttatttacaggaacgcgtggtgtaggtaaaactacaattgcacgtattttagccaagtgt
ttgaactgcgaaacaggtgtgacttcaacgccgtgtgaagtctgtgcaacgtgtaaagcg
gtaaatgaaggtcgctttattgacctgatcgaaatcgatgctgcttcaagaacaaaagta
gaagatacacgtgaacttttagacaacgttccttatgcgccaacgcaaggtcgttttaaa
gtttacctgattgacgaagtgcatatgctttctacgcattcttttaatgcgttattaaaa
acactagaagaaccaccagaacacgttaagtttctgtttgctacgactgacccacaaaag
ttaccaattacggtcatttcacgttgtttgcaatttactctacgacctttagctgtcgat
gaaattaccaggcaccttggcgctattcttgaaaaagagcaaattaatgccgatcaggat
gcaatttggcaaattgctgaatctgctcaaggttcattacgtgatgcattatctttaact
gaccaagccattgcttatggtcaaggttctgtacatcatcaagatgttaaagaaatgctt
ggcttgattgatcgtacaattatttatgatttgattttagcgattcatcagaaccaacgt
gagaaagttagtcagcttttattgcaatttagacatcaagcgttagatgtttcactggtg
cttgatcagttgatttcgacattgcatgaattggcaattttgcaatatctacctgatttg
agtttgaaatatagcgatgaaatcaatcgcaaaatcatgcaactgtctaagctgatttct
gctcaagatttgcagctttattaccaaatcgcatgtaaaggtcgttcagacttgcaactt
gccgtgacgcaagagcaaggttttgaaatgtgcgttttacgtttattagcattccgtcct
ttagcgccaaatgaaattttagtatcagagcctgttcaacaaaatggacaagcagtgatg
aatcaccaagtacagcaacaagttcaagatattgctcctgtaagtgctgttcagcctgtt
gaagttattagtcaacccgttatggttgaacctgaacctgaacctgaacctgaacctgaa
cctgaacctgaacctgaacctgaacctgaacctgaacctgaacctgaacctgaacctgaa
cctgaacctgaacctgaacctgaacctgaacctgaacctcagtctaatcaggatttaatg
gtatttgatccaaatcatcatgagttgattggacttgagtcagcagttgttcacgagact
gttagtgttctggaagaagatttcattccgttaccagaacaaaagtttgtacaagttcag
gcagaaacccaagcaaaacaaattgaaccagaatcagctttttctgctgagcctcaaggt
ttgtttgagacatctagcgctgaattttcccttgatcaagatgcgcctataactcctgat
ttgtcttctgaacctgttattgaacaacagtcatttgtacaagccgaagtaatggttcaa
acagaaacagttgcagttgtgaaagagtctagcgaaactgataacgggcagctgatgcct
caagatatcttgaagctggctcctcaagttttagaaggtgagtggtcacttgaaaagtgg
gaatattggtttagaaatagtcaactttcacccgctgttcaagaacttgcgcagcatggt
gtgatgactggtgaaattggcggcaatactattttccatattcctcaagaatatgaaaat
atgctgacccaattgcagcaaggccttattgatgcattaaatgagcaatggccgaatact
caatttacagttgaatatggtgctttgaatacatctacaccatataccattcaaagtgcg
cgtaaagaaaaagcttttcaccgagcagccgagctgttacagcaacagccagttattaag
agtctcatagaaacttttgatggcgaactacaaaatattcaattaaagccttaa

KEGG   Acinetobacter oleivorans: AOLE_10850
Entry
AOLE_10850        CDS       T01263                                 
Name
(GenBank) hypothetical protein
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_10850
   03430 Mismatch repair
    AOLE_10850
   03440 Homologous recombination
    AOLE_10850
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_10850
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_10850
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_10850
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_10850
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_10850
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA
Other DBs
NCBI-ProteinID: ADI91059
UniProt: D8JL19
LinkDB
Position
complement(2332919..2333899)
AA seq 326 aa
MNPNVTSKIYPWQKTTWDTLTTRFPNIGHGLLFYGKEGCGKHAFAKHFLAWVLCLNKQPH
GACGECSSCQWLKSDTHPNYVHITTDEENKKQNAKIKIEKIRDLLPFVQQTGEGWRVILI
EPAEALNLASSNALLKTLEEPGERVVLILLADHYLKLPATIRSRLQHFALDRISYEQATS
YLNEHLSEIAEVQPDLLLGLSNDMPLQAIEIAKSDWFTKRQIFLNDWLKIVAQKNMPLFF
SGKWQKELSFSDFIVLFEYLLGDLICVKLNQPQKNTDLDFDQLIPYYDLESLFNIYSELQ
QAKKLVEQNVQSQLIIDQLFITLMNV
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaatccgaatgtaacttcaaagatttatccttggcagaaaacaacttgggacacctta
acaacaaggtttcccaatattggacatggtctgttattttatggcaaggaaggctgtggg
aaacatgcttttgctaagcatttcttggcttgggtgctttgtctaaataagcagcctcat
ggtgcttgtggtgagtgtagcagctgccaatggttaaaatcggatactcatccaaattat
gtccatatcacaacagatgaagaaaataaaaagcaaaatgcaaaaataaaaatcgaaaag
attcgagatttgctgccttttgtgcaacaaacaggagagggttggcgcgttattcttatt
gaacctgctgaagctctaaacttggcatcttcaaatgcgctattaaaaaccttggaagaa
ccaggtgagcgcgttgttttaattttattggccgatcactaccttaaattaccagccact
attcgtagccgattgcagcactttgctttagatcgcatttcatatgagcaggctacttca
tatttgaatgagcatttatctgaaattgcagaagtccaacctgatttattacttggtcta
tctaatgatatgcctttacaagccatagaaattgcaaaaagtgattggtttactaaacga
cagattttcttaaatgactggctaaaaattgtagctcaaaaaaatatgcctttatttttc
tcaggaaaatggcaaaaagaattaagttttagcgattttatcgtactttttgagtacttg
ttgggagatttaatttgtgtcaagctaaatcaaccgcagaaaaatacagatttagatttt
gatcaattaattccatattacgatttggaaagcttattcaatatttatagtgaactacaa
caagcaaaaaagcttgttgagcaaaatgtacaaagtcaacttattatagatcaattgttt
ataacgttaatgaatgtttaa

KEGG   Acinetobacter oleivorans: AOLE_11360
Entry
AOLE_11360        CDS       T01263                                 
Name
(GenBank) DNA polymerase III DnaE
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_11360
   03430 Mismatch repair
    AOLE_11360
   03440 Homologous recombination
    AOLE_11360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_11360
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_11360
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_11360
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_11360
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_11360
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger HHH_6 PHP tRNA_anti-codon
Other DBs
NCBI-ProteinID: ADI91161
UniProt: D8JLC1
LinkDB
Position
2436781..2440344
AA seq 1187 aa
MQFVHLGIYTEFSITESIVRIPDLVNAAVKDQMPALALTDLSNLHAAVKFYNACLKKGIK
PLLGSTIRLDDAQHRATLLAMSDVGWKSLTEIVSRGFIEGQQLSIPCVKKEWVLEQHQDI
IVLLGQHSDVGQMLCSSNPQKAAPLLEAWLEKFGNRVYLALTRTDRPGEEDFIQEAAKLA
AQYNVGVVAHNDVHFVEKEDFEAHEARVCIADGYVLADNRRPRIYSPEQHFKTSDEMIEL
FSDIPSAIENTYHIAKRCNVKLQLGTYFLPDYPIPDGFTIDTYFEHLSKVGLEERLNYLY
PVEKRGEDWPEIRKPYDERIDYEVGIILKMGFPGYFLIVMDFIQWAKNNGVPVGPGRGSG
AGSLVAYSLKITDLDPLRYDLLFERFLNPERVSMPDFDVDFCIAGRDRVIDYVSRTYGRE
AVSQIATFGTMAAKGAIRDVARVLGKSYGLADRISKMVPTKPLGVDLATAIDMEPQLKDI
VTNPSNPDNDDASEIWEMALKLEGVTRNTGKHAGGVVIAPGKITDFSAVLCDADGTNRVA
QYDKDDVEAAGLVKFDFLGLRNLTVIEDAIQNINKNRDSNDQLNILHVPLDDAKAYSVFA
DANTTAVFQFESVGMKRMLKEARPSKFEEIIAFVSLYRPGPMDLIPDFIHRMHGGDFEYL
HPLLEGVLEPTYGIMVYQEQVMQTAQICAGYTLGGADLLRRAMGKKKPEEMVKQRQIFLE
GAAEKGIDESTANHIFDYMEKFAGYGFNKSHAAAYALVAYHTAWLKAHYPAEFMAAVMTS
EMQNTDSVVFLIDDCRNNNLEVLPPSVNMSTYHFHASNDKTIVYGLGAIKGVGEQAMQSV
IDSRRQFGPYTDLFDFCHRIDLKKINKRTLEALIRAGALDCLGIERASLMAQLPEAVQAA
EQARSNRESGIMDLFGEVEEVQRKPAKPVKPWSDEVRLKGEKDTLGLYLTGHPIDVYRQE
LKAFIPVKLNEITATRRGVTTVYAGLVIDVANFPNRVVIVLDDGTARIEVSCNHERFQRF
KDIVQVERVVVFEGEIYEREGFDRPMGRLTKAFTLNEIRQKRANSIQIKLTEEFMQPTLA
KDLQNMILPFCNVDMHQHISLQLQIDQSYAQAELQFGPQWKVAPLDELLAKLRDYFGKDN
IYIEYQVKSKAAKAADPVRPHAVAPPPAGMSMDDALDLYQSEVSQYS
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgcagtttgttcatctaggtatttatacagaattttcgattacagagtcgatagttcgc
atacctgacttggtcaatgctgcggttaaagaccaaatgcctgcgttggcattaactgac
ctctctaacctccatgcggcggtaaaattttataatgcttgtttaaaaaaaggcattaag
cctcttttaggtagtacgattcgccttgatgatgctcaacaccgtgcaacattacttgca
atgagtgatgttggatggaaaagtctcaccgaaatcgtttcacgcggttttattgaagga
caacagctcagtattccatgtgtaaaaaaagaatgggtacttgaacagcatcaagatatt
atcgttttacttggccagcatagtgatgttggtcagatgctttgttcatctaacccacaa
aaagcagctccccttttagaagcatggctcgaaaagtttggtaaccgtgtttatcttgct
ttaacacgtaccgaccgtcctggtgaagaagactttattcaagaagcagctaaacttgct
gcacaatataatgttggtgtagttgcacataatgatgtgcactttgtagaaaaagaagat
ttcgaagcacacgaagcacgtgtttgtatcgctgatggttatgtactcgcagataatcgt
cgtccacgcatatatagtcctgagcagcactttaaaacctcagatgaaatgatcgaattg
ttttccgatattcctagcgctatcgagaacacctatcatattgctaaacgctgtaacgtt
aaactgcaactcggaacttactttttacctgactatccaattccagatggttttaccatc
gatacttattttgaacatttatctaaagtaggcttggaagagcgcttaaattatctttac
cctgttgaaaaacgtggtgaagattggccagagattcgtaagccttacgatgaacgaatt
gattatgaagtcggtattatcctgaagatgggtttccccggctacttcctcatcgtcatg
gacttcattcaatgggcaaaaaataatggtgtgccagttgggccgggtcgtggttcaggt
gcaggttcattagtcgcatacagcttaaaaattacagaccttgacccacttcgttacgat
ctgctcttcgaacgtttcttgaacccagaacgtgtatcgatgcctgactttgacgtcgat
ttctgtattgctggacgtgaccgcgttattgattacgtatcgcgtacttatggtcgtgaa
gccgtttcacaaattgcaactttcggaaccatggcagcaaaaggtgcaatccgtgacgtt
gcgcgtgtattgggtaaatcttacggtttagctgaccgtatttcaaaaatggtgcctacc
aaaccactcggtgtggatttagctaccgctattgatatggaaccacagcttaaagatatt
gtgaccaacccctctaacccagataacgacgatgcaagtgaaatctgggaaatggcatta
aaattagaaggtgtaacccgaaatacgggtaaacatgccggaggtgtagttattgcacca
ggtaaaattaccgatttctcggctgtactttgtgatgcagacggaacaaaccgcgttgct
caatatgataaagacgatgtagaagcagcaggtctggtcaagttcgacttcttgggttta
cgtaacttaaccgttattgaagacgcgattcaaaatattaataaaaaccgcgacagtaat
gatcaactcaatatcctgcatgttcctctagacgacgctaaagcttattctgtctttgcc
gatgcaaatacaacagcggtattccagtttgaatccgtcggcatgaaacggatgcttaaa
gaagcacgtccaagcaaatttgaagaaattattgcattcgtatccttgtatcgtccgggt
ccaatggacctgattcctgactttattcaccgtatgcatggtggagattttgaatatctc
catcctcttttagaaggtgtattagaaccaacttacggaattatggtttatcaggaacag
gtaatgcagactgcacagatttgtgcaggttataccttaggtggcgcagacttactacgc
cgtgcaatgggtaaaaagaaacctgaggaaatggtcaaacagcgccaaatcttcttagaa
ggtgctgctgaaaaagggattgacgaaagcacagcaaaccatatctttgactatatggaa
aagtttgcaggctatggttttaacaaatctcacgcggctgcttatgccctagttgcctac
catactgcatggttaaaagctcattaccctgctgagtttatggcagcggtaatgacatcc
gaaatgcaaaacacggacagtgttgtatttttgattgatgactgtcgaaacaataatctt
gaagtcttaccaccatcagtcaacatgtcgacttatcacttccatgcaagtaacgataaa
acgattgtttatggtttaggtgcaattaagggcgtcggcgaacaagcaatgcagtcagtt
attgactctcgtcgacaatttggtccttatacagatctattcgatttttgccatcgtatt
gatttgaagaaaatcaataagcgtactcttgaagctttaattcgcgcgggtgcactcgat
tgcttaggaattgaacgtgcaagcttaatggctcaattgcctgaagctgttcaagccgct
gaacaagctcgaagtaaccgtgaaagcggaattatggatttatttggtgaggttgaagaa
gttcagcgtaagccagctaaaccagtaaaaccatggagtgacgaagttcgtctcaaaggc
gaaaaagatacgcttggtttatatttaaccggtcatccaattgatgtttaccgacaagaa
ctcaaagcttttattcctgtaaaactaaacgaaattactgcgacgcgtcgtggtgttaca
acggtttatgcaggtttggtcattgatgtcgcaaacttcccgaaccgtgtggttattgta
ctagatgatggtacggcacgtattgaagtcagctgtaaccatgagcgtttccaacgtttt
aaagatattgtgcaagttgaacgtgttgtcgttttcgaaggcgaaatctatgagcgagaa
ggctttgatcgtccaatgggacgtttaaccaaggctttcacgttaaatgaaataagacaa
aaacgtgctaacagtattcaaatcaaattgacagaagagttcatgcagccaacactggca
aaagatctgcaaaacatgatcttgccattttgcaatgtagatatgcatcaacatatctct
ctacagttacagattgatcaatcctatgctcaagccgaacttcagtttggtccgcaatgg
aaagtcgctcctctagatgaattacttgctaaactcagagattattttggtaaagataat
atttatattgaatatcaagtaaagtcgaaagcagctaaagcagcagaccctgttcgtcca
catgctgttgcccctcctcctgcgggtatgtctatggacgatgcattggatttataccaa
agcgaagtttctcaatattcgtaa

KEGG   Acinetobacter oleivorans: AOLE_14070
Entry
AOLE_14070        CDS       T01263                                 
Name
(GenBank) bifunctional ribonuclease HI/DNA polymerase III subunit epsilon
  KO
K14159  ribonuclease HI / DNA polymerase III subunit epsilon [EC:3.1.26.4 2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_14070
   03430 Mismatch repair
    AOLE_14070
   03440 Homologous recombination
    AOLE_14070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_14070
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_14070
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_14070
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     AOLE_14070
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_14070
    RNase H
     AOLE_14070
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_14070
SSDB
Motif
Pfam: RNase_H RNase_T Rv2179c-like DNA_pol_A_exo1 RVT_3
Other DBs
NCBI-ProteinID: ADI91701
UniProt: D8JPC7
LinkDB
Position
3011272..3012648
AA seq 458 aa
MSQTITLYVDGACRGNPGLGGWGAYVITEQGEHKLFGGEPETTNNRMELTAAIEGVSFCP
PDAHLIIWTDSNYVKQGITEWIHGWKKKNWKDVKNPDLWQKLDAVCAGRNIEWNWIKGHA
GHAGNEMADELANIGADQTALQKKTVQATALQDIKKPEEDWLLDDPFGFDMAEVAEEDNI
DLEQPEEVEMIIVEEEVIEVEAAEPESKQSINNIHPQIVVTEAKLQLQGPRQLILDTETT
GFYFQDGDRIIEVGAIEMINRKLTGSSIHIYINPQKPVGDSENIHGISDNFLKDKPLYAE
IADTLFDYLKGAEIIAHNATFDMNFLDMEFRRAGLPALSEVCEVTDTLALAKSKHPGQKN
SLDALVRRYEIPARDRTFHGALLDAEILSDVYLAMTGGQVSFDIDALSQSENSQNTTNKT
RIQIDLPVIYPSEEELNTHETWVKEFEKKHGEPCLFAK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgtctcaaacaatcacactgtatgttgatggtgcatgtcgtggcaatccgggtttaggt
ggttggggcgcatatgtcattaccgagcagggtgagcataaattatttggcggtgaacct
gagacaaccaataaccgtatggagcttactgctgcgattgagggtgtttcattttgccca
cccgatgctcacttaattatctggacagattcaaattatgtgaagcaaggcattactgaa
tggattcatggctggaaaaagaaaaactggaaagatgtaaaaaatcctgacctttggcaa
aaattagatgctgtatgtgcaggtagaaatattgagtggaactggattaaaggccatgct
ggacatgcaggcaacgaaatggccgatgagcttgcaaatatcggagccgatcaaaccgca
cttcaaaaaaaaacagttcaagcgactgctctgcaagatataaaaaagcctgaagaggat
tggttgcttgatgacccttttgggtttgatatggcagaagtagccgaagaagataatatt
gatcttgaacagcccgaagaagttgagatgattattgtggaagaagaagttattgaagtt
gaagctgctgaaccagaaagtaagcaatccattaataatattcatcctcaaattgttgtg
actgaagccaaattacaattacaagggcctcgacaactgattctcgatacggaaaccact
ggtttttatttccaagatggcgaccgaattattgaggtgggcgctattgaaatgattaac
cggaaacttaccggtagctcaattcatatttatattaacccgcaaaaaccagtgggtgac
tcagaaaatatccatggtatcagtgataatttcttaaaagataaaccgctctatgcggaa
attgccgacacgctctttgattatctaaaaggcgcagagattattgcgcataacgcaacc
ttcgatatgaacttcctagatatggagtttagacgcgctggccttcccgcgctttccgaa
gtatgtgaggtaacagatacgttagctttagcaaaaagcaaacatcctggacaaaaaaac
tcgcttgatgctcttgtaagacgttatgaaattccagcacgtgaccgtaccttccacggt
gcattactcgatgctgaaattctttcagacgtttacctagcaatgacaggtggacaggtt
tcttttgatatagatgccttatcccaaagtgaaaatagccagaacacaacaaataaaact
aggattcaaattgacctaccagttatttacccttctgaagaagagctaaatacacatgag
acttgggtcaaagaatttgagaaaaaacatggagaaccttgcctttttgcaaaataa

KEGG   Acinetobacter oleivorans: AOLE_16740
Entry
AOLE_16740        CDS       T01263                                 
Name
(GenBank) DNA polymerase III, delta subunit
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_16740
   03430 Mismatch repair
    AOLE_16740
   03440 Homologous recombination
    AOLE_16740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_16740
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_16740
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_16740
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_16740
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_16740
SSDB
Motif
Pfam: DNA_pol3_delta DNA_pol3_delt_C
Other DBs
NCBI-ProteinID: ADI92235
UniProt: D8JGB7
LinkDB
Position
3568831..3569820
AA seq 329 aa
MKIDYLQALKRTPEARGAWILHGQEPLLEQNLLDAFRKSWQQQEVERQRYDISSVSDWKN
VFNALNSLSLFSQQLAIEVHGNIKPDANGLKQLKSYIQHNEHNLLLIVLPKQDSSSLKSA
FFQVVEANGVVVALTANYPQDRQRILSAEADKLEIQLDNDAWQWLMQHHEHNLLAAKNSL
MRVRDTFPDQQLIQIEQLYACLQDQSRYTTYDLSDALLEGNLGQSIKIFQYLIAAGEPDS
LILWTLSKEMRLLMQLFEQPHNALQLGIWKTKVSLYQQALRRLNPQQFLGWSTLLLQIDA
AIKGMSNENAEHLMQQAIAELCGKTLFIQ
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaaaattgattatttacaagccttaaaacgtactccggaagctcggggtgcgtggatt
ttacatgggcaagagcctttattagaacaaaatttattagatgcctttcgaaaaagctgg
caacaacaagaagttgaaagacagcgctatgatattagtagcgtaagcgactggaaaaat
gtctttaacgcacttaatagcttatctttattttctcagcagcttgctattgaagtacac
ggcaatataaaacctgatgcgaatggcttaaaacaactcaaaagctatatacaacataat
gaacataacctgctattaattgttttacctaaacaagatagtagtagcttaaaatctgct
tttttccaagttgttgaagcaaatggggttgtagttgccctcacggcaaattacccacaa
gatcgccaaagaattttatctgctgaagcagataaacttgaaattcaactcgacaatgat
gcttggcagtggttaatgcaacatcatgagcacaatttgcttgcagctaaaaatagcttg
atgcgtgtaagagacacatttccagaccaacaactcattcaaattgaacaactatatgcg
tgcctacaagatcaatcacgctataccacctatgatttaagtgatgcattattagaaggc
aaccttggccaatctattaagatttttcaatatttaattgcagcaggcgaacccgatagt
ctgattttatggactttaagtaaagaaatgcgtttgttgatgcaattgtttgaacaaccc
cataatgccttacagcttggtatctggaaaacaaaagtcagcttatatcaacaagcatta
agaagactaaatccacaacagtttctaggctggtctacccttctattgcaaatcgatgca
gcaattaaaggaatgtcgaacgaaaatgcagaacatttaatgcagcaagcgattgctgaa
ttatgtggaaaaacattatttatacagtaa

KEGG   Acinetobacter oleivorans: AOLE_18265
Entry
AOLE_18265        CDS       T01263                                 
Name
(GenBank) DNA polymerase III chi subunit, HolC family protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_18265
   03430 Mismatch repair
    AOLE_18265
   03440 Homologous recombination
    AOLE_18265
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_18265
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_18265
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_18265
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_18265
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_18265
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: ADI92535
UniProt: D8JIC6
LinkDB
Position
3894297..3894704
AA seq 135 aa
MAKVSFYLFETSEERQVDSACRLCRKILQKHPKIWWYCPDMQLQQMLDERLWEFDPVSFI
AHGVDQTDAAVCISAKQPLEQGLLVFNFNNHALEQVDHFSHIIEIVENNETAKQIGREKF
KMYRRLGIEPRTFKL
NT seq 408 nt   +upstreamnt  +downstreamnt
atggctaaagttagtttttatctgtttgaaaccagcgaagaacggcaagtcgatagtgct
tgccgtttatgtcgaaaaatattacagaagcatcctaaaatctggtggtattgcccagat
atgcagctacaacagatgcttgatgaaagattatgggaattcgaccctgtcagtttcatt
gcgcatggcgttgaccagactgatgctgctgtatgtatttcggctaaacaaccacttgaa
caaggcctgttagtatttaattttaacaatcatgcacttgaacaagttgatcattttagc
cacattatagaaattgttgaaaataatgaaacagccaagcaaattggtcgagaaaaattt
aaaatgtatcgccgtttgggtatagaaccgcggacctttaaattataa

DBGET integrated database retrieval system