KEGG   Acinetobacter oleivorans: AOLE_00795
Entry
AOLE_00795        CDS       T01263                                 
Name
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03410  Base excision repair
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AOLE_00795
   03430 Mismatch repair
    AOLE_00795
   03440 Homologous recombination
    AOLE_00795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_00795
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     AOLE_00795
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     AOLE_00795
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AOLE_00795
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AOLE_00795
SSDB
Motif
Pfam: DHHA1 DHH RecJ_OB Toprim
Other DBs
NCBI-ProteinID: ADI89062
UniProt: D8JLF8
LinkDB
Position
180031..181731
AA seq 566 aa
MTKIQIKQRPLLTRPEQFQGVPPFIAEILARRGVESEQELELKLKNLLAPQLKGLETAVA
LIDQAIDEQKKIVIVGDYDADGATSTALMVLVLRDMGAQVDYLVPDRFKYGYGLTPAIAE
LAHQTYQPDLLITVDNGISSHAGVDTAHALGMQVIITDHHLTTKETPLAEAVVNPNQLGC
DFPSKALAGVGVAFYVLANLASLRSRQGKSTSKVTQYLDLVALGTYADVAVLDYNNRILV
DAGVKRIQQHQCRVGILALLDIAGREASSLRAQDLGFVLGPRINAAGRMESMRIGIECLL
ADSMETAYPIAQQLNQLNIERRQIEGEMKQQALSALDSLQLSKEDIPPALVLFEENWHQG
VIGIVAGRLKEQFHRPAIVFAPDEDGVHIKGSARSIDGVHIRDMIEQVAEQHPELVSHFG
GHAAAAGLTIRKENFDAFKTVFTGCVAAMEESLFQATLWTDGELPASALQLDTLDWIEQL
GPWGQKFPFPQFEGHFKVVDYRWLKETHLKLRLALDQYTFDAIAFNAAGRFEFNPMRDEV
HLVYEIDRNVFKGNVNLQLRIVHLNQ
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgacaaaaatacaaatcaaacaaagacctttattgacacgccctgaacagtttcagggc
gtgcctccgtttattgccgagattttggcaaggcgtggagtagaatctgaacaggaatta
gagctaaagcttaagaatttattagccccacagctcaaggggctagaaaccgctgtggca
ttaatagatcaagctattgatgaacagaaaaagattgttattgtcggtgactatgatgcg
gatggagctactagtacagcgttaatggtattggtgcttcgcgatatgggagcacaagtc
gactatttagttccagaccgatttaaatacggatatgggcttacccccgcaattgcagag
cttgcacatcaaacttatcaacctgatttattaattacagttgataatggaatttccagt
catgctggagttgatacagcccatgcgctgggcatgcaagttattattaccgatcatcac
ttaacaacaaaagaaacgcctctagcagaagcggtggttaacccaaatcagttaggctgt
gattttccaagtaaggcgcttgctggtgttggtgttgcattttatgtgctggccaatttg
gcaagtttacgtagcagacaaggtaaaagcacaagtaaagtcactcaatatctagattta
gtcgctttgggaacttatgcagatgtggctgttctagactataacaaccgtatattggtc
gatgcgggcgtaaaacgtattcagcaacatcagtgtcgagttggaatattggcactgttg
gatattgctggccgagaggcgtcgtctttgcgtgcacaagatctaggttttgttttaggt
ccgcgtattaatgctgctgggcgtatggagagcatgcgaatcggtatagagtgtttatta
gcagactctatggaaacagcttacccgattgctcaacaattaaatcagttgaatatagag
cggcgacaaattgaaggagagatgaagcaacaagctttatctgctttagatagtttgcag
ctctcaaaagaagatattcccccagctctggtgctctttgaagaaaactggcatcaaggc
gtgattgggattgtcgcagggcgtttaaaagaacagtttcatcgcccagctattgtcttt
gcaccagatgaagatggtgtccatattaaaggatctgcacgttcaattgatggtgtgcac
attcgagatatgattgaacaggttgctgaacaacatccggaattggtgagccattttggt
ggacatgcggcggcggcaggtttaacgatacgtaaagaaaattttgatgcttttaaaact
gtttttactggctgtgttgcagctatggaagaatctttatttcaagcaacgctatggacg
gatggggaattaccagcttcggctttgcaactagacacattggactggatagagcagctt
gggccatgggggcaaaaattcccttttcctcagtttgaaggacattttaaagttgtcgat
tatcgctggcttaaagaaacacatctaaaacttagattggctcttgatcaatatactttt
gatgcgattgcttttaatgccgctggacgatttgaatttaatcctatgcgagatgaagtt
catttggtctatgagattgatcgtaatgtatttaagggtaatgtaaatttacaattgcgt
attgtgcatttaaaccaataa

DBGET integrated database retrieval system