KEGG   Acinetobacter oleivorans: AOLE_00910
Entry
AOLE_00910        CDS       T01263                                 
Name
(GenBank) excinuclease ABC subunit A
  KO
K03701  excinuclease ABC subunit A
Organism
acd  Acinetobacter oleivorans
Pathway
acd03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    AOLE_00910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_00910
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AOLE_00910
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      AOLE_00910
SSDB
Motif
Pfam: UvrA_inter UvrA_DNA-bind ABC_tran SMC_N AAA_29 AAA_16 AAA_22 RsgA_GTPase AAA_23 AAA_33 AAA_21 DnaJ_CXXCXGXG AAA_25 BCA_ABC_TP_C Viral_helicase1 AAA_24 cobW MMR_HSR1 NACHT ChuX_HutX
Other DBs
NCBI-ProteinID: ADI89085
UniProt: D8JLI1
LinkDB
Position
complement(209466..212297)
AA seq 943 aa
MSQSHIRIRGARTHNLKNVSLDIPRDKFVVITGLSGSGKSSLAFDTLYAEGQRRYVESLS
AYARQFLSQMEKPEVDSIEGLSPAIAIEQKSTSHNPRSTVGTITEIYDYLRLLYARVGTP
YCPEHDLPMVAQTISEMVDAVKTLEEGTALMLLAPVVRERKGEYSNLFEQLQGQGFVRAR
VDGEIIDIDTPPELDKKKKHTIEVVVDRFKVREDLGNRIAESFETALRLGGDIAVLSWMN
GEHPDRVFSAKHSCPECDRAVAELEPRLFSFNNPFGACPVCDGLGTRSHFSSEKLIPNPD
LAISEGAIRGWDRQRPYYYSMLQKVADHFGFQLDTPWNQLDKDTQKKFLQGTGKEKVDLS
YIDERGRKHTRVQPFEGILPHLERRYRETESNYVRDDLAQYLSNAACDACDGSRLNEISR
HVRVKDKTIADITRMSIGDAESYYQDLNLEGAKGEIADKIFKEIRERLHFLVSVGLNYLS
LARSAETLSGGEAQRIRLASQIGAGLMGVMYVLDEPSIGLHQRDNDRLLQTLIRLRDLGN
TVLVVEHDEDAIRAADHIIDIGPGAGIHGGVIIAEGTYDELANHADSLTGQYLSGKLKIE
IPKQRTQSPRPDEFIKLSGASGHNLKNVDLKIPLGIMTCVTGVSGSGKSTLINRTLLPLA
ATQLNGATTLTAEKFDSIDGLQHLDKVVDIDQSPIGRTPRSNPATYTGLFTPIRELFAQT
PEAKARGYSAGRFSFNVKGGRCEACEGDGMIKVAMHFLPDMYVPCDACHGKRYNRETLEV
GYKGKNISDVLEMTVEDAAEFFSAIPVIHRRLETLTQVGLGYIRLGQAATTLSGGEAQRV
KLARELAKRDTGKTLYILDEPTTGLHFHDIAKLLDILHELRNKGNTIVVIEHNLDVIKTA
DWVVDLGPEGGSGGGMIIAEGTPEQVADVEISHTGRFLKPMLK
NT seq 2832 nt   +upstreamnt  +downstreamnt
atgagccaaagtcatatccgtattcgaggcgcacgtacccataatttaaaaaatgtgtct
ctcgatattccacgcgataagtttgtggtaattacggggttatcaggttcaggaaaatct
tctcttgccttcgataccctgtacgccgaaggacaacgccgttacgtcgaatcgctttcg
gcctatgctcgccaatttttatcgcaaatggaaaagcctgaagtcgattcgattgaaggt
ttatctccagcgattgccattgagcaaaaatctacgagtcataacccacgttcaacggta
ggtacgattaccgaaatttatgactatttgcgtttgctttatgcacgtgtcggtacgcca
tattgccctgaacacgacttgccgatggttgcacaaactatttctgaaatggtcgatgcg
gtaaaaacacttgaagaaggcacagcactcatgttgcttgcccctgtcgttcgtgaacgt
aaaggtgaatacagcaacctgttcgagcaactacaaggccaaggttttgttcgtgcccgt
gttgatggtgaaatcatcgatattgatacgccacctgaactcgacaaaaagaaaaagcac
accatcgaagttgtcgttgaccgctttaaagtgcgtgaagacttaggtaaccgtattgcc
gaatcatttgaaactgcactgcgtttaggtggcgatattgctgttttgtcatggatgaat
ggcgaacatcctgatcgtgttttttctgcgaaacattcatgtcctgagtgtgatcgtgca
gtcgcagagcttgagcctcgcttattttcatttaacaacccgttcggtgcctgccctgtt
tgcgatggcttaggtacacgcagtcattttagttctgaaaagctcattccaaatccagat
cttgcaattagtgaaggggctattcgtggctgggatcgtcaacgtccatattactattcg
atgctacaaaaagttgccgatcattttggttttcaacttgatacgccttggaaccagcta
gataaagacactcaaaagaaattcttacaaggtactggcaaagaaaaagttgatttaagc
tatatcgatgagcgtggtcgtaaacatactcgcgtacaaccatttgaaggaattttgcct
caccttgaacgtcgttaccgtgaaactgaaagtaactatgtacgagacgacttagctcaa
tacctttctaatgcagcgtgtgatgcatgtgatggctcacgtctaaatgaaatttcacgt
catgttcgcgttaaagataaaacgattgccgacattactcgcatgtcgattggtgatgct
gaaagttattatcaagatttaaatcttgaaggcgctaaaggtgaaatcgctgataaaatc
tttaaagagattcgtgaacgtttacatttcttggtgagtgttggacttaactatttaagt
ttagctcgttctgccgaaacgttatcgggcggtgaagcacagcgtatccgtttagcctca
caaattggtgcaggtttaatgggtgtgatgtatgtccttgatgaaccatcgattggccta
catcaacgcgataatgatcgtctattacaaacgctgattcgcttacgtgatttaggtaat
acggtattagtcgttgaacacgatgaagatgctattcgtgcagccgaccatattattgat
atcggtccgggagccgggatacatggtggcgtgattattgccgaaggaacttacgatgaa
ttggctaatcacgctgactcactcacaggtcaatacctttctggcaaactgaaaattgaa
ataccaaaacaacggactcaatcaccacgcccagatgagttcatcaagctttctggtgca
agtggtcataatcttaaaaatgtcgatttaaaaattccgctcggcattatgacttgtgtg
actggtgtttcaggttcgggtaaatcgacactcattaaccgcactttgcttccattggct
gcaacacaactcaatggcgcaacgaccttaacagctgaaaagtttgactcaattgatggt
ctacaacaccttgataaagttgttgatattgaccaaagtccgattggacgtacaccacgc
tctaaccctgcaacgtacacagggctatttacgccaatccgtgaattatttgctcaaacg
ccagaggcaaaagcgcgtggttatagtgcaggccgtttctcgtttaacgtgaaaggcgga
cgctgtgaagcctgtgaaggcgatggcatgattaaggtcgcaatgcacttcttgccagac
atgtatgtaccttgtgatgcatgtcatggcaaacgttataaccgtgaaacacttgaagtc
ggttataaaggcaaaaacatttctgatgttttagaaatgacggttgaagatgctgctgaa
ttctttagtgcaattccagtcattcaccgccgcttagaaaccttaactcaggtgggctta
ggctatattcgtttaggtcaagctgcgaccactctctctggtggtgaagcacagcgtgta
aaactagcgcgtgagttagcaaaacgagatacgggtaaaactttatatatcttggatgaa
ccaacaacaggtctacatttccacgatattgccaagttactcgacattttgcatgagcta
cgcaacaaaggtaataccattgtggtgattgaacataaccttgatgtgattaaaacagct
gactgggttgtcgacttaggtccagaaggtggttcgggcggtggtatgatcattgccgaa
ggcacacctgaacaagtggctgatgttgaaatttcccatacaggtcgtttcttaaagccg
atgttgaaataa

DBGET integrated database retrieval system