KEGG   Acinetobacter oleivorans: AOLE_00960
Entry
AOLE_00960        CDS       T01263                                 
Name
(GenBank) ssDNA-binding protein controls activity of RecBCD nuclease
  KO
K03111  single-strand DNA-binding protein
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_00960
   03430 Mismatch repair
    AOLE_00960
   03440 Homologous recombination
    AOLE_00960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_00960
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_00960
   03029 Mitochondrial biogenesis [BR:acd03029]
    AOLE_00960
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    AOLE_00960
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     AOLE_00960
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AOLE_00960
Mitochondrial biogenesis [BR:acd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    AOLE_00960
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: ADI89095
UniProt: D8JLJ1
LinkDB
Position
219963..220553
AA seq 196 aa
MRGVNKVILVGTLGRDPETKTFPNGGSLTQFSIATSEAWTDKTSGERKEQTEWHRIVLHN
RLGEIAQQFLRKGSKVYIEGSLRTRQWTDQNGQERYTTEIRGEQMQMLDGRQQGEQGFAG
GNDFNQPRFNAPQQGGNGYQNNNNQGGGYGQNNGGGYGGQGGFGNGGNSPQGSGFAPKAP
QQPASAPADLDDDLPF
NT seq 591 nt   +upstreamnt  +downstreamnt
atgcgtggtgtaaataaggttattttggttggtactttgggtcgtgatcctgaaacaaaa
acttttccaaatgggggctcgctgactcaattttcaatcgcaacaagtgaagcttggacc
gataaaacttcaggtgagcgtaaagaacaaactgaatggcaccgtattgttttgcataac
cgtttaggggaaattgctcagcagttcctacgtaaaggttctaaggtttatattgaaggt
tcattacgcacgcgtcagtggactgatcaaaatggtcaagagcgctatacaacagaaatt
cgtggcgaacagatgcaaatgttagatggtcgtcaacaaggtgaacaaggtttcgctggc
ggtaatgattttaaccaaccacgttttaacgcacctcaacaaggtggtaatggttatcaa
aataataacaaccaaggtggcggctacggccaaaacaatggcggtggttatggtggccaa
ggtggtttcggtaatggtggtaacagcccacaaggtagtggtttcgctcctaaagcgcca
caacaacctgcgtctgcaccagctgatttagacgacgatttaccgttctaa

DBGET integrated database retrieval system