KEGG   Acinetobacter oleivorans: AOLE_04390
Entry
AOLE_04390        CDS       T01263                                 
Symbol
ruvA
Name
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:5.6.2.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_04390 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_04390 (ruvA)
Enzymes [BR:acd01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     AOLE_04390 (ruvA)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOLE_04390 (ruvA)
    RecFOR pathway proteins
     AOLE_04390 (ruvA)
SSDB
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH Transposase_20 5_3_exonuc Ribosomal_S13
Other DBs
NCBI-ProteinID: ADI89775
UniProt: D8JEC5
LinkDB
Position
complement(967828..968427)
AA seq 199 aa
MIGCLIGEVFALEAPTVLLNVNGVGYEIDTPLSTFCQLQKGQKVTLWTHLVVREDAQQLY
GFSDAQEKIIFRTLLKVNGVGPKMALGILSTLSVELLVHTIEHDDINTLIKVPGVGKKTA
ERLMIELRDRFKTLAQGTSSTTTLPQIQFAANSPVAEAEAALQSLGYKPLEAQKAVAAVK
ADYTESADIIRAALKSMMK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgatcggatgtttaattggcgaagtgtttgccctagaagcccctactgtcttactgaat
gtaaatggtgtgggttatgaaattgatacgccactttcaacattttgccaattacaaaaa
ggccaaaaagttacgttatggacgcatttggttgtccgcgaagatgctcaacagctttac
ggtttcagtgatgctcaagaaaaaataattttccgcaccttattaaaagtaaatggtgtc
ggcccgaaaatggcattagggattctatcgacgttaagtgttgagttactagtgcacacg
attgaacatgacgacatcaacacgttaataaaagtcccaggcgttggcaaaaaaacagcc
gagcgtttaatgattgaacttcgtgaccgtttcaaaacactggctcaaggaacttcttct
acgactaccctgcctcaaattcagtttgctgcaaactctcctgtggcagaagcagaagca
gctttgcaatctttaggttacaagccacttgaggcacaaaaagctgttgctgctgttaaa
gccgattacaccgaatcagccgatattattcgcgctgctctaaaatcaatgatgaagtaa

DBGET integrated database retrieval system