KEGG   Acinetobacter oleivorans: AOLE_04580
Entry
AOLE_04580        CDS       T01263                                 
Name
(GenBank) DNA repair protein RecO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_04580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_04580
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AOLE_04580
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AOLE_04580
SSDB
Motif
Pfam: RecO_C RecO_N
Other DBs
NCBI-ProteinID: ADI89813
UniProt: D8JEG3
LinkDB
Position
1002656..1003369
AA seq 237 aa
MMRNEVLHGYMIHHRKYREKSHIVHLFTQEYGRVDGILRQTPPPQYQPIRLQATGKSELK
NFTKLEILNQPVFFFGDAFFAGFYLNEVVLRLCPLEETMPQTFEQYQLTLLQLQQLSSHE
NPDLFLRQILRQFEHILLPELGYALDFSVDAQQQPIQAHQFYQFQVTEGFAPVVQASRSS
LSGKAILSMLDYEQGQDFSLEQLQLLGKLYRQMITSLLGDRPLKSRQLWIQNTQTQS
NT seq 714 nt   +upstreamnt  +downstreamnt
atgatgcgcaatgaagtcctccatggatatatgattcatcaccgtaagtaccgtgaaaaa
agtcatattgtgcatctttttactcaggagtatgggcgagtcgatggtattttaagacag
actccgccccctcaatatcagcctatccgcttgcaagccacgggtaaaagtgagctgaaa
aactttacaaagcttgaaatcttaaatcagcctgttttcttttttggtgatgcttttttt
gctggattttatttaaatgaagttgttcttagactttgtccattagaagagacaatgcca
caaacgtttgagcaatatcagttaacgttacttcaattacaacaattatcttcccacgaa
aatcctgacctttttcttcggcagattttgcgccagttcgagcatattttacttcctgaa
cttggatacgcacttgatttctcagtcgatgcccaacaacagccgattcaggctcatcag
ttttatcaatttcaagtgacagagggttttgctcctgttgtgcaggcgagtcgttcttct
ttgtcagggaaagcgattttgtctatgttggattatgagcaagggcaggatttttctctc
gaacaattgcaattattaggtaaactataccgtcaaatgattacatcgcttttaggtgat
cgtcccctaaaaagtcgacaattgtggattcaaaacactcaaactcaatcgtaa

DBGET integrated database retrieval system