KEGG   Acinetobacter oleivorans: AOLE_04635
Entry
AOLE_04635        CDS       T01263                                 
Name
(GenBank) excinuclease ABC subunit B
  KO
K03702  excinuclease ABC subunit B
Organism
acd  Acinetobacter oleivorans
Pathway
acd03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    AOLE_04635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_04635
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AOLE_04635
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      AOLE_04635
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR DEAD AAA_30 Kinesin AAA_5 DUF87 SWI2_SNF2 Microtub_bd AAA_22
Other DBs
NCBI-ProteinID: ADI89824
UniProt: D8JEV8
LinkDB
Position
1012036..1014057
AA seq 673 aa
MNENQPFDLVTHYQPAGDQPQAIEKLVNGIEHGFRNQLLLGVTGSGKTYTMANVIAQTQR
PTIVMAHNKTLAAQLYGEFKSFFPNNAVEYFVSYYDYYQPEAYVPSSDTFIEKDAAINDH
IDQMRLSATRALLERRDAIIVASVSAIYGLGDPNAYMQMLLHVVEGDRVSRDEIIRRLVE
MQYTRNELEFLRGTYRIRGEIIDIFPAESDQHAIRIELFDDEVDSIRWFDPLTGKMVRKV
SRVTIYPKSHYVTPKDHLTRAIDTIKDELQDQLKFFREHDKLLEAQRIEQRTRYDLEMMQ
QLGYTNGIENYSRHLSGRPSGEAPPTLFDYIPEDALLIIDESHVTVPQIGAMYKGDRSRK
ENLVNYGFRLPSALDNRPMKFEEWERIVPTTIFVSATPAKYELEKSDQIVEQVVRPTGLI
DPEIEIRPVLTQVDDVLSEINIRKSLNERVLITTLTKRMAEDLTSYLKEYGVKVAYLHSD
IDTVERVKIIHELRTGVFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTI
GRAARNVKGKAILYADRITDSMQKAIDETDRRRAKQIEFNELHGITPRSAVRQAVKEIDS
GEVLSDDEIDEKVLEQAQALSADERHILSDPKLFTKHITKLEKDMLKASKDLQFEQAARI
RDEILRLKAQMLQ
NT seq 2022 nt   +upstreamnt  +downstreamnt
ttgaacgaaaatcaaccttttgatttggtcactcattatcagccagcaggtgatcagcca
caggcaattgaaaagctggtcaatggtatcgagcatggttttcgtaatcagttattgcta
ggggtaactggctcaggtaagacctataccatggcaaatgtgatcgctcaaacacagcgc
cctacaattgtgatggctcataacaaaactttggctgcccaactttatggtgagtttaaa
tctttcttccctaataatgcggttgaatattttgtaagttattacgattactaccagcca
gaggcttacgttccatcttcggatacgttcatcgaaaaagatgcagctattaatgatcac
attgaccagatgcgattatctgcaacacgagctttattagaacgtcgcgatgcaattatt
gtggcatcggtgtctgcaatttatggtttgggtgatccaaatgcttatatgcaaatgttg
ctgcatgtggtcgagggtgaccgagtaagccgtgatgaaatcatccgtcgtttggttgaa
atgcaatatacgcgtaatgaacttgagttcttacgtggtacatatcgaattcgtggtgaa
attattgatattttcccagcagaatctgatcaacatgccattcgaattgaactatttgat
gatgaggtcgactcaatccgttggtttgacccgcttacaggtaaaatggttcgtaaagtt
tctcgggtaacgatttatccgaaaagccactacgtaacaccgaaagatcatttaacgcgt
gcgattgatacaattaaggatgaattacaagatcaacttaaatttttccgtgaacatgac
aaattactcgaagcacagcgtattgagcaacggacacgttacgatctggaaatgatgcaa
cagctgggttataccaatggtatcgaaaactactcacgtcatttgtcgggacgaccatct
ggtgaagctccgccgactttattcgactatattccagaagatgctttactgattattgat
gaatcacacgttaccgttccacaaattggagcgatgtataaaggtgaccgatcgcgtaaa
gaaaacttagtaaactatggcttccgtttaccaagtgcgcttgataaccgtcctatgaaa
tttgaagagtgggaacgtattgtaccgaccaccatttttgtaagtgcaacacctgctaaa
tatgaattagaaaagtcagaccaaatcgttgaacaggtggtacgtccaacaggtctcatc
gaccctgaaattgagattcgtcctgtcttaacccaagtggatgatgttctttctgaaatt
aatattcgtaagagtttgaatgaaagggtattaattacgactttaacgaagcgtatggca
gaagatctgacttcatatttaaaagaatatggcgttaaggtggcttatctccactcagat
attgatacggttgaacgtgtcaaaattattcatgaattacgtacaggcgtatttgatgtt
ttagtcggtattaacctgctacgtgaaggtctggatatgccagaagtttctttggtcgct
attttagatgcagataaagagggctttttacgttcggaacgttcacttattcagacaatt
ggtcgtgctgcgcgtaatgtaaaaggtaaagcaattttatatgctgaccgaattactgac
tctatgcaaaaggcaatagatgaaactgatcgtcgtagagccaagcaaattgaatttaat
gagttgcatggtattacgcctcgtagtgcggttcgtcaggctgtcaaagaaattgactcg
ggtgaggtactttcagatgacgagattgatgaaaaagtacttgaacaagcacaagcattg
agtgccgatgaaagacatattctttcagaccctaaattgtttactaaacatattactaag
cttgaaaaagacatgttaaaggcctcgaaagatttacagtttgagcaagcagcgcggata
cgtgatgaaattcttcgattaaaagcgcagatgttgcaataa

DBGET integrated database retrieval system