KEGG   Acinetobacter oleivorans: AOLE_05480
Entry
AOLE_05480        CDS       T01263                                 
Name
(GenBank) Exonuclease family protein
  KO
K10857  exodeoxyribonuclease X [EC:3.1.11.-]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AOLE_05480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_05480
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.-
     AOLE_05480
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     AOLE_05480
SSDB
Motif
Pfam: QSregVF_b RNase_T ExoX-like_C DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: ADI89993
UniProt: D8JFR2
LinkDB
Position
complement(1201532..1202218)
AA seq 228 aa
MQTIILDTETHTLNGLPIEIAYAPIEINEGKLTLDKSKLFDQLYQVGAPISYAAMAVHHI
LESDLENQPHYKTFKLPESTTYIIGHNIDYDIAAIARCGVDVSNIKPICTLALARKVWPE
AEAHNISALIYMISQGSSKARELLKGAHRADADIILTANILMHIVYHLNIQDIEELYRVS
EEARIPTTVNFGKHKGTAIAELPKDYIQWLLRQDELDIYLRKALESVL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcaaaccattattttagatacagaaacacatacactaaatggtttgcctattgaaatt
gcatatgccccgatcgaaattaatgaaggcaagctcaccttagataaaagcaaattgttt
gatcagctctatcaagtcggtgcccctatttcctacgccgctatggcagttcaccatata
ttagagtcagatttagaaaaccagcctcactataaaacgtttaaattaccagagagcacg
acttatattattggtcacaatattgattacgatattgccgcaattgcgcgttgcggtgta
gatgtatcgaatattaaaccgatttgtactttagctttagcgcgtaaagtttggcctgaa
gcagaagcacataatatctccgccctcatctatatgatttctcaaggcagcagtaaagct
cgtgaattactcaaaggtgcacaccgtgccgatgcagatattattttgactgctaatatt
ttgatgcatattgtctatcatttaaatattcaagatattgaagagctataccgagtttct
gaagaagcacgtatccccacaacggttaactttggtaagcataaaggcacagcaattgct
gaacttcctaaagactatattcaatggttattacgccaagatgagcttgatatttacctt
cgcaaagcattagaaagtgtactttaa

KEGG   Acinetobacter oleivorans: AOLE_07430
Entry
AOLE_07430        CDS       T01263                                 
Name
(GenBank) DNA polymerase III, epsilon subunit
  KO
K10857  exodeoxyribonuclease X [EC:3.1.11.-]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AOLE_07430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_07430
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.-
     AOLE_07430
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     AOLE_07430
SSDB
Motif
Pfam: RNase_T QSregVF_b DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: ADI90377
UniProt: D8JHY5
LinkDB
Position
complement(1610404..1611084)
AA seq 226 aa
MKAIILDTETNKLNGYPIEIAYASIGIENGQLLVQKDEVFNRFYSCPEPIDLEAMAVHNI
IEADIEGQPSCETFRLPEGVEFIVGHNIDYDIKALNKCGPAIKAKTICTLALARDVWPDL
PSHKLAVLYYFVMSNREEARKHLRHAHSARADIYFTGIILIALIERLGIKDLNSLFLMSE
AVRLPKIMSWGKHKGTPLKDLPHPYITWLLNKEDLDPHLRKALQNI
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaaagcaattattttagatactgaaaccaataaattaaatggttatccaatcgaaatc
gcttatgcatctattggcatagagaatggtcaattattggttcaaaaagatgaggttttt
aaccgcttctattcttgtcctgaacccattgatttagaagctatggctgtacacaacatc
attgaagcagatattgaaggtcaaccaagttgtgaaacgttccggttacctgaaggtgtt
gaattcattgtcggccacaatattgattacgacattaaagctctaaataaatgcggacca
gcaattaaggcaaagacaatttgtactttagctttagcaagggatgtttggcctgattta
ccaagtcataaattggctgttctttactatttcgtgatgagtaaccgtgaagaagcacgt
aagcatttaagacatgcacattcagcacgggcagatatttattttactgggattatccta
atagctctaattgaacgactaggaattaaagacctgaattctttattccttatgtctgaa
gcagttcgattacccaaaattatgtcttggggcaaacacaaaggaacccctcttaaagac
ttaccgcatccatatatcacttggctactgaataaagaagacctagacccacatttgcgt
aaagcgcttcaaaatatttaa

DBGET integrated database retrieval system