KEGG   Acinetobacter oleivorans: AOLE_06285
Entry
AOLE_06285        CDS       T01263                                 
Name
(GenBank) replicative DNA helicase
  KO
K02314  replicative DNA helicase [EC:5.6.2.3]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_06285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_06285
Enzymes [BR:acd01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     AOLE_06285
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    AOLE_06285
SSDB
Motif
Pfam: DnaB_C DnaB AAA_25 divDNAB ATPase
Other DBs
NCBI-ProteinID: ADI90150
UniProt: D8JGJ6
LinkDB
Position
complement(1370893..1372338)
AA seq 481 aa
MSQANATSLTLSSPTENKTSESGQLKEFRTPPHNLAIEQAVLAALMTVAESFEQVSDLLK
ENDFYATRHKYIYRAIEKLAQENSPYDAVLVSDWLLKQNLLDAIGGEEYLMQLMADSPSS
FYNLETYASKIKEFSTLRSMIKVSTEILQNAYDTKGRGVSEILDLAETSIFSLAEQHNNN
KKDAGPKSISSVTADVISKLDELSKLDGNITGLTTGFLELDNKTSGMQPGDLIIVAARPS
MGKTTFAMNLVESVLQYNKLPALVFSMEMPADSIAMRLISAMGKVHQGHLRSGNLDADEW
TKVTGTILQLQQMHLYIDDSSALPPTELRARARRVAKMHDGKIGCIMVDYLQLMKVPGMG
DNRVGEISEISRSLKALAKEMQCPVIALSQLNRSLENRPNKRPVMSDLRESGAIEQDADL
IMFIYRDEVYNKESKEAGTAEIIIGKQRNGPIGSVRLAFEGQYTRFSNLSPEYYSQYDDE
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtctcaggcgaatgccacttctttaaccctttcatctccaacagaaaataagacgagt
gaatcaggccaacttaaagagtttcgcactcccccacacaatttagccattgaacaggct
gttcttgcggccttaatgacagttgccgaatcttttgaacaagtcagcgacttattaaaa
gaaaatgatttttatgcaacacgtcacaaatatatctatcgtgccattgagaaactagca
caagaaaactctccttatgatgctgtgttagtaagtgactggctcttaaaacaaaattta
ctcgatgcaattggtggtgaagagtatttgatgcagcttatggctgattcaccatcaagt
ttctataacttagaaacgtatgccagtaaaattaaagaattctctacgcttcgcagcatg
attaaagttagtactgaaattttacaaaatgcttatgacacaaaaggtcgtggtgttagc
gaaattctagacttggccgaaacaagtattttctctttagcagaacagcacaataacaat
aaaaaggatgcaggtcctaaatctattagctctgttaccgccgatgtaattagtaaactt
gatgagctctcaaaactcgatggcaatattacaggtttaaccacaggcttcttagaactt
gataataaaacatctggtatgcagcctggtgacttaattattgttgctgcacgtccatcg
atgggtaagactacttttgccatgaatttggttgaaagtgttttgcaatataacaagcta
cccgctctggttttctctatggagatgccagcagattcgattgcgatgcgtcttatttct
gcaatgggtaaagttcaccaaggacatttacgttcggggaacttagatgcagatgaatgg
accaaagtgactggtaccattttacaacttcaacaaatgcatttgtatattgatgactca
tctgccctacctccaacggaacttcgtgcccgcgctcgacgcgttgcaaaaatgcatgat
ggcaaaattggatgtatcatggtcgattacttgcagctcatgaaagttcctggcatgggt
gataaccgtgtaggtgagatttccgaaatttcacgtagcttgaaagcattagcaaaagaa
atgcaatgcccagttatcgcactttcccagctcaaccgaagtctggaaaaccgtccaaat
aaacgcccagtaatgtccgacttacgtgaatctggtgcgatcgagcaggatgccgactta
attatgtttatttaccgtgatgaggtttataacaaagagtctaaagaagctggtaccgca
gaaattattattggtaagcagcgtaacggtccaattggttcagtccgtcttgcctttgaa
ggtcaatatactcgatttagtaatctctctcctgagtattacagccaatatgatgatgaa
gaataa

DBGET integrated database retrieval system