KEGG   Acinetobacter oleivorans: AOLE_06590
Entry
AOLE_06590        CDS       T01263                                 
Name
(GenBank) DNA mismatch repair ATPase
  KO
K03572  DNA mismatch repair protein MutL
Organism
acd  Acinetobacter oleivorans
Pathway
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AOLE_06590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_06590
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Molecular matchmaker
     AOLE_06590
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c DUF5435 DUF3676
Other DBs
NCBI-ProteinID: ADI90211
UniProt: D8JGQ7
LinkDB
Position
1441561..1443510
AA seq 649 aa
MTDEKLTQRRIHTLDAALANQIAAGEVIERPSSVVKELLENSIDAGATELIVRIAQGGST
LIEIIDNGHGIHSEDLALAVMRHATSKIKTAEDLHAIVSLGFRGEALASIAAVSRLTLTS
SQDESGIGHQVEVNGTAFDHQEVQAVAAQKGTHIRVQDLFFNVPARRKFLKKPTTEFGHI
EEIVRRLALTHFDIRFVLEHNDNIRINLPIADSGELRFQRVQQLLGSQFVQNAYWMDAES
ISMRLSGWLGHPSDARAQADMQYVYVNGRIVKDKTISHALRMAYDGILHGHQHSSYLLFL
EVDPENIDVNVHPTKHEIRFLNQREVHEFVRHYAKETLSQFQTASADLAQAMKVDEQSDY
SVQPQPKYQEQFSLHRANETLNADSEPQTQHAPTELLTDFNASRPQAVHYADQTPKYNGS
AQLNNALKTYLAPLRDQPATFSLNENIEPVTKFDEFPLGIAIAQLHGIYILAQNTEGLII
VDMHAAHERILLQQMKNAWDKPEFWTSQQLLIPKVISISRMQAVRVEELKPQLERLGLEI
DLYGDEQVIVRGVPAILQKADFENLIPELLNDLDPNDEAQGLLQKRDELLAGMACHGAVR
AHRQLSLSEMNALLRQMEQTEFASQCNHGRPTWRAFPLSQLDKLFARGE
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgactgatgaaaagctaacacaacgtcgtatccatacattagacgcagcgttagccaac
cagattgctgctggtgaggtgattgagcgtccttcatctgttgttaaagaattattagaa
aactctatcgatgccggtgcaactgaactcatcgtgcgaattgctcaaggtggttcgacc
ctaatagaaattattgataatgggcatggtattcattctgaagatttagcactagctgtt
atgcgtcatgccacaagtaaaattaaaacggcagaagatttacacgctattgtaagttta
ggatttcgaggggaggcacttgcttcgattgctgctgtttcaagattgacattgaccagt
agccaagatgaaagcgggatcggccatcaagttgaagtaaacggcacagcatttgatcat
caagaagtacaagctgttgctgctcaaaagggaacccatatacgtgttcaggacttattt
tttaatgttcctgcacgccgtaaattcctaaaaaaaccaaccactgaatttggccatatc
gaagagattgttcgccgtttggctctaacacatttcgatatacgttttgtgcttgagcat
aatgataatattagaattaatttacctatagcggatagcggcgagctgcgttttcagcga
gtacagcaattattaggttcgcaattcgtacaaaatgcatattggatggatgctgaaagt
attagcatgcgtttatcgggttggctaggccatccttctgatgcacgtgcgcaggctgat
atgcaatatgtctatgtaaatgggcgtattgtcaaagataaaacaatttcgcatgcttta
cgcatggcatatgatggtattttacatggtcatcaacattcatcttatctacttttctta
gaagtcgatcctgaaaatattgatgtcaatgttcatcctacaaaacatgaaattcgcttt
ttaaatcaaagagaagtgcatgaatttgtaaggcattatgcaaaagaaactctatcgcaa
tttcagacagcgagtgctgatttagctcaagcgatgaaagtagatgaacaatcagattat
tcagtacagccgcagccgaaatatcaagaacaattttcattgcaccgagcaaatgaaact
ttaaatgcagatagtgagccacagactcagcacgcaccaacagagttattaaccgatttt
aatgctagtcgtccgcaagctgttcactatgcagatcaaacaccaaaatataatggttct
gctcaattaaataatgcgttaaagacatacttagcgcctctacgtgaccaacctgctact
ttttcattaaatgaaaatattgaaccagtaactaaatttgatgaatttcctttaggtatc
gcaattgctcaacttcatggaatttatattctagcgcagaataccgaagggcttattatt
gttgatatgcatgcggcacatgagcgtattttattacaacaaatgaaaaatgcttgggat
aaacctgaattttggacatctcagcagttacttatacctaaagtcatttctattagccgt
atgcaggctgttagggtagaggagttaaaacctcaacttgagcgcttaggtttggaaatt
gatttatatggcgatgagcaagttattgttcgtggtgtgcctgccatattacaaaaagca
gattttgaaaatcttattccagaacttttaaatgatttagatccaaatgatgaagcccaa
gggttacttcaaaaaagagacgagttattagctggaatggcatgtcatggggcagtgcgt
gcacatcgacaactcagcctttctgaaatgaatgctttacttcgtcaaatggaacaaact
gaatttgcgagccaatgtaaccatgggcggccaacttggcgtgcatttccattatctcaa
ttagataaattatttgctcgaggagagtag

DBGET integrated database retrieval system