KEGG   Acinetobacter oleivorans: AOLE_07375
Entry
AOLE_07375        CDS       T01263                                 
Symbol
recA
Name
(GenBank) recombinase A
  KO
K03553  recombination protein RecA
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_07375 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_07375 (recA)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOLE_07375 (recA)
    RecFOR pathway proteins
     AOLE_07375 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AOLE_07375 (recA)
SSDB
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_25 AAA_24 AAA_16 TK MobB AAA_35
Other DBs
NCBI-ProteinID: ADI90366
UniProt: D8JHX4
LinkDB
Position
complement(1603421..1604467)
AA seq 348 aa
MDENKSKALQAALSQIEKQFGKNTVMRLGDNTVQAVEAVSTGSLTLDIALGIGGLPKGRI
VEIYGPESSGKTTMTLQAIAQCQKTGGTCAFIDAEHALDPQYARKLGVDIDNLLVSQPDN
GEQALEIADMLVRSGAIDLIVVDSVAALTPKAEIEGEMGDSHMGLQARLMSQALRKITGN
AKRSNCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIGQVKEGDEIVGSE
TRVKVVKNKMAPPFREAIFQILYGKGTNQLGELVDLAVQQDIVQKAGAWYSYQGNKIGQG
KNNVIRHFEENPQMAGEIERNIREQLLTTGTNTAQVEDEEEVDLLLES
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggatgagaataaaagcaaagcattacaagccgcgctaagtcaaattgagaaacaattt
ggcaaaaatacggtgatgcgtctcggtgacaacactgttcaagctgttgaagctgtatct
acaggctctttgactttagatattgcattggggattggcggtttaccaaaaggtcgtatt
gtagagatttatggtccagaatcttctggtaaaaccacaatgactctacaagcaattgca
caatgtcaaaaaactggtggtacttgtgcctttatcgatgcagagcatgcattagatcca
caatatgcgcgtaagcttggtgtagacattgataatctgcttgtatcgcaacctgataac
ggtgaacaagcactcgaaattgcagatatgctcgttcgttctggtgcaattgacttaatc
gttgtcgactcagtcgctgcacttactcctaaagcagaaattgaaggtgagatgggtgac
tctcatatgggcttgcaagctcgtctaatgagtcaggcacttcgtaaaattacgggtaat
gctaaacgttcaaactgtatggttatcttcattaaccagatccgtatgaagattggagta
atgtttggtagtccagaaaccacaactggtggtaacgcattgaagttctacgcttctgta
cgtttagatatccgccgtattggccaagtaaaagaaggcgatgaaatcgtcggctctgaa
actcgagttaaagtggttaaaaacaaaatggctcctcctttcagagaggctattttccaa
atcctatatggtaaaggcacaaaccagctaggcgaacttgtagatttagctgtacaacaa
gatatcgtacaaaaagcaggcgcttggtattcatatcaaggtaataaaattggtcaaggt
aagaacaatgttattcgccactttgaagaaaaccctcaaatggctggggaaattgaacgt
aacatccgtgaacagttattaacaactggtactaatactgctcaagttgaagatgaagaa
gaagttgatcttctactagaatcttaa

DBGET integrated database retrieval system