KEGG   Acinetobacter oleivorans: AOLE_10360
Entry
AOLE_10360        CDS       T01263                                 
Symbol
recR
Name
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_10360 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_10360 (recR)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AOLE_10360 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AOLE_10360 (recR)
SSDB
Motif
Pfam: Toprim_4 RecR Toprim Toprim_2 Ras_bdg_2
Other DBs
NCBI-ProteinID: ADI90961
UniProt: D8JKE0
LinkDB
Position
complement(2234194..2234790)
AA seq 198 aa
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCH
SLTEHEICDICASTEREDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSQGKIEEVILATNATVEGQATAHYLVEATKHLPIQMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMRMK
NT seq 597 nt   +upstreamnt  +downstreamnt
gtgtttagcgatagatttgaacaactcgttcaagctttacgtatattgcctagcgttggt
ccgaaatcggctcaacgtatggcattacatcttttgatgaaaaatcgagaaggtgcgttt
gcattagcccatgctttacatgaagcttcaagttatattcatgagtgcagcgtttgccat
tctttaactgaacatgaaatttgtgatatttgcgcctcaactgagcgagaagatcaacta
ttgtgtgtggttgaatcaccagcagatgtaatggcgattgagcaaagcggaagtttccgt
ggtaaataccatgttttaggtgggcatctatcacctttagatggtattggtccagaagaa
attggtattccttatctgattcagcgtttaagccaaggcaaaattgaagaagtgattctg
gcaacaaatgcgactgtagagggacaggcaaccgctcattatttggtagaagcgactaag
catttacctatacaaatgacacgtattgctcaaggtgtaccgcaaggtggtgaacttgag
tatgtagatagccataccttaagtcaggcagttcataatcgtatgagaatgaaataa

DBGET integrated database retrieval system