KEGG   Acinetobacter oleivorans: AOLE_10625
Entry
AOLE_10625        CDS       T01263                                 
Name
(GenBank) transcription-repair coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:5.6.2.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    AOLE_10625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_10625
Enzymes [BR:acd01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     AOLE_10625
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      AOLE_10625
SSDB
Motif
Pfam: TRCF UvrB_inter CarD_CdnL_TRCF DEAD Helicase_C ResIII ERCC3_RAD25_C RecG_dom3_C Glyco_tran_WecG AAA_30
Other DBs
NCBI-ProteinID: ADI91014
UniProt: D8JKJ3
LinkDB
Position
complement(2286131..2289592)
AA seq 1153 aa
MFQQEISQLNLQQLKAGEKRWVGSLLGSSAALLFKEIAVQHSSLLVVVARNNQHVAQLES
ELEFYGIKPTIFPDWEILPYDRLSPHQDIVSERLAILSNMPQKGVLLLSASTLAQRVAPY
SWVLGEHFDIHVGQKFDLEQQKLRLVQAGYHLVDTVYDHGEFAVRGSIMDIFASGQEAPI
RIDLFDDEIDTLKFFDPETQRTTTALKSFTVLPAKEFPLKEARSIFRDRYSELFPTANPK
KNPIYQDVLEGIASPGIEFYLPLFFDKAQMQSQSTLTTYLPKNCIVITTNDVDTDLTNFW
KEVFRRYEDRRHNVDQPILPPEELFIAPNHLLSALNQFPRMLVSAELVEEKAGALNLKAE
QPPKLAVDPKKEKPFTVVKKYIDEANHPVLLVAESAGRRESLRDGLRASLGDIPSVDSFE
QFQTSQFAIAITNAPLDRGLVLTDQLTVISENQLYEHRVVQRRRKRQQEVSEEFLIRSLT
ELSIDAPVVHIDHGVGRYAGLVTLAIEGQDYEFLQLNYAEGAKVYVPVTNLHLISRYSGG
DPDLAPLHKIGSDAWSKAKRKALEQIHDVAAELLHIQARRQSKPGFGFELDQSLYMQFAS
GFAYEETLDQANAIEATLHDMQQARPMDRLVCGDVGFGKTEVAMRAAFVAVQNGKQVAVL
VPTTLLAQQHYESFKDRFADWPVRIEVLSRFGSSKTHTKNIEDLIAGKVDIVVGTHKLLQ
ENVQFKDLGLMVVDEEHRFGVRDKERIKALRADVDMLTLTATPIPRTLNMAFSGMRDLSI
IATPPARRLAVKTFVQEHTEASVKEAILRELLRGGQVYFLHNEVDTIERAAENIRVLVPE
ARVAVAHGQMRERELEQVMQQFYHKEFNVLVCSTIIETGIDVPNANTILIERADKLGLAQ
LHQLRGRVGRSHHQAYAYLLVPSIKHLKGDAEKRLDAIQRASTLGAGFMLATEDLEIRGA
GELLGEQQSGSMQAIGYSLYMEMLEKATKAIQQGKTPNFDAPLSLTAEINLHIPALIPDE
YLGDVHQRLLFYKRISNTDTQEKLDNIRMELIDRFGVPPQSVKHLFTVHQIRLKAEQLGI
TKIDINTQGGNIEFSPDTPVQAISIIQLMQKHPTYYRMEGGQRLKVMVQLEEQEKRIQFI
NDLLAKLLNELHA
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgtttcaacaagaaatctctcaattgaatttacaacagctcaaggccggtgaaaagcgt
tgggtggggtcgttattaggttcatctgctgcattattatttaaggaaattgctgttcag
cattcgtctttacttgttgtggttgccagaaataaccagcatgtagctcaattagaaagt
gaacttgaattttatggcataaaaccaacaattttccctgattgggaaatcttaccgtat
gatcgtttgtcacctcatcaagatattgtttcagaacgcctcgcaattttatctaatatg
cctcagaagggtgtgttgctcctttcagcaagcactttagcccaaagagttgcaccatat
tcatgggttttaggtgagcattttgatattcatgtaggtcaaaaatttgatttagaacag
caaaaattacgtttagtacaagctggttatcatttagtagatactgtttatgatcacggt
gagtttgctgtgcgtggcagtattatggatatttttgcctcaggacaagaagcacctatc
cgtattgatttgtttgatgatgaaattgatacattaaaattctttgatccagaaacacaa
agaacgactacagctttaaaaagttttacagttttacctgcaaaagaattcccattaaaa
gaagcccgctcaatttttagagatcgatattctgaactttttcctactgctaatcctaag
aaaaacccgatttatcaagatgtcttagagggaattgcttctccaggaattgaattttac
ttaccattattttttgataaagcacaaatgcaatcgcaaagtacacttacaacgtactta
ccaaagaattgcattgtaattacaactaatgatgtagacaccgatttaactaatttttgg
aaagaagttttccgtcgttacgaagacagacgtcataatgtagatcagccaattcttcct
cctgaagaactatttattgctccaaaccatttactgagtgctttaaaccagttcccgcgt
atgcttgtaagtgccgaattggttgaagaaaaagctggcgcattaaatcttaaggctgag
cagccgccaaaattagcagtcgatccgaaaaaggaaaaaccgtttaccgtcgtcaaaaaa
tatattgatgaagcaaatcatcctgttttattggttgcagaaagtgcaggccgacgtgaa
agcttaagagatggtttacgtgctagtctgggagatatccctagtgtagacagttttgaa
caatttcaaacgagtcagtttgcgattgctattacaaatgcaccgctcgaccgtggctta
gttttaacagaccaattaactgtaatttcagaaaatcagttatatgaacatcgggtagtt
cagcgtcgtcgtaaacgtcagcaagaagtttcagaagagttcttaattcgcagtttgact
gaactcagtattgatgccccagttgttcatattgatcatggtgtgggacgttatgcagga
ttagttactttagcaattgaagggcaagattatgaattcttgcaactcaattatgctgaa
ggggcaaaagtttatgttcctgtgactaatttgcatctgatcagtcgctatagtggtggc
gatcccgatctagcgccacttcataaaattggaagtgatgcgtggagtaaagctaaacgt
aaagctttagaacaaattcatgatgttgcagccgaactattacatatacaagcacgtcgt
cagtcaaaacctggttttggtttcgaactcgatcaatcgctttatatgcaatttgctagt
ggatttgcctacgaagaaacactcgatcaggcgaatgctattgaagcgactcttcatgat
atgcagcaagctagacctatggatcgacttgtttgtggtgatgtcggttttggtaaaact
gaagtggcaatgcgagccgcatttgttgctgtgcaaaatggtaagcaagttgctgtttta
gtgcctacgactttacttgcacaacaacattatgaatcttttaaagatcgttttgctgat
tggcctgtgcgtatagaagtgctatcacgctttggctcaagtaaaacccatacaaaaaat
attgaagatctaattgctggtaaagtcgatattgtggtgggaacacataaacttttacaa
gaaaatgtgcaatttaaagatctgggcctaatggtagtcgatgaagaacatcgattcggt
gtgcgtgataaagagcgtatcaaagctttacgagcagatgtggacatgttgacgcttacc
gcaacgcctattccacgaactttaaatatggctttttctggaatgcgtgatctatctatc
attgctacaccgccagcccgtcgtttagctgttaaaacctttgtgcaagagcatacagaa
gcctctgtgaaagaggcgattttgcgtgagttactacgtggtggccaagtatatttctta
cacaatgaagtcgatacgattgaacgggctgctgaaaacatccgtgttcttgtacctgaa
gctcgtgtggcagttgctcatgggcaaatgagagaaagagagctcgaacaagtgatgcag
cagttctatcacaaagaatttaacgtattggtatgttcaaccattattgaaaccggaatt
gatgttccaaatgccaatacaattttgatagaacgggctgacaaactcggtttggctcaa
ttacatcaattacgtggacgtgtagggcgctcacatcatcaagcctatgcttatttgtta
gttccttctataaaacacttaaaaggcgatgcagaaaaacgtttggatgcaattcagaga
gcttccactctcggtgctggctttatgttagctacagaggatttagaaattcgtggtgct
ggtgaacttttaggtgaacaacaaagcggttcaatgcaggcaatcggttatagcttgtat
atggagatgctggaaaaagccactaaagcaattcagcaaggtaaaacaccgaattttgat
gcacctttatcgctgactgcggaaattaatttacatattccggcattgattccagatgag
tatttaggagatgtgcatcagcgtttattgttctataaacgtattagtaatacagataca
caagaaaaactcgataatatccgtatggaacttattgatcgttttggggttccgccgcaa
tcggttaaacatttgtttactgtccatcagattcgcttgaaagcagagcaactgggtatc
acaaaaatcgatattaatactcaaggtggtaatattgaattctcacctgatacacctgtt
caagcgattagtatcattcagctgatgcaaaagcatccgacctattatcgtatggagggc
ggacagcgtttaaaagttatggttcagttagaagaacaggaaaagcgcatccaatttatt
aatgatttattagctaaattattaaatgaattacatgcttaa

DBGET integrated database retrieval system