KEGG   Acinetobacter oleivorans: AOLE_11085
Entry
AOLE_11085        CDS       T01263                                 
Symbol
ruvC
Name
(GenBank) Holliday junction resolvase
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.21.10]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_11085 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_11085 (ruvC)
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.10  crossover junction endodeoxyribonuclease
     AOLE_11085 (ruvC)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOLE_11085 (ruvC)
    RecFOR pathway proteins
     AOLE_11085 (ruvC)
SSDB
Motif
Pfam: RuvC
Other DBs
NCBI-ProteinID: ADI91106
UniProt: D8JL66
LinkDB
Position
2380509..2381054
AA seq 181 aa
MALIIGIDPGSRLTGYGIIEKDGSKLRFVDAGTIRTETQEMPERLKRIFAGVERIVKFHG
PTEAAVEQVFMAQNPDSALKLGQARGAAIAALVNLDLQVAEYTARQIKQSVVGYGAADKE
QVQMMVMRLLNLTIKPQSDAADALAAAICHAHASGSMSKLSVLNALGGMARGRSRSSSRR
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atggcattgattattggaattgacccgggttcacgcttaacaggttatggaatcattgaa
aaagatggtagtaaactgcgttttgttgatgctggtacaatccgaactgaaactcaagaa
atgccagaacgcttaaagcgtatttttgctggcgttgagcgaattgtgaaatttcatggt
cccacggaagctgcggttgagcaggtctttatggctcaaaacccagactctgctttaaaa
ctggggcaagctcgtggtgctgccatagccgcattagttaatttagatttacaagttgca
gaatatactgcccgtcaaattaaacagtctgtcgttgggtatggtgcagcagacaaagaa
caagtacaaatgatggtcatgcgattacttaacttgacgattaaacctcaatccgatgca
gccgatgctcttgctgccgctatttgccatgctcatgcatcgggaagtatgagtaaactt
tctgtccttaatgccttaggtggtatggcacgtggacgaagccgctctagcagtcgtaga
cgttaa

DBGET integrated database retrieval system