KEGG   Acinetobacter oleivorans: AOLE_12955
Entry
AOLE_12955        CDS       T01263                                 
Name
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
acd  Acinetobacter oleivorans
Pathway
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AOLE_12955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_12955
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AOLE_12955
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_IV MutS_II Disulph_isomer
Other DBs
NCBI-ProteinID: ADI91478
UniProt: D8JNC5
LinkDB
Position
2772104..2774743
AA seq 879 aa
MNSAEIMADLSTHTPMMQQYLKVKKDYQHALLFYRMGDFYELFFEDAHLAAKLLGITLTH
RGKANGNPIPMAGVPYHSAEGYLARLVKAGRTVAICEQVGEVTGKGPVDRKVVRILTPGT
LTDDALLSSYQSSNLVSLCIHQNQIGFALLDLSAGIFKVQQQDYKPEQLPIELARLMPSE
ILIDEDLVDTNIIEQIKKHLECPVTKRPNVDFNLNNAQKTLCDQFTVSTLSGFGLDPLPL
AKAAAAALIHYAKETQKTALPHIRSIQLEQSTDFIALDPITRRNLEIIEPLFEHGTSLFQ
LVNDCQTAMGGRLLSRTLMQPVRDTALLDARLDAIEQLIQGYHESPVRLVLKEIGDIERV
LSRVALGSARPRDLVQLRHACAQIPALRTALTPVIQAKKSKLLVQLDQELGDFKALHQHL
MAAIVENPPVLLRDGNVIAEGYDADLDELRQIRDHAGQFLIDLEIKERERTGINTLKIGY
NRVSGYYIELTRAQAEQAPADYIRRQTLKNAERYITPELKSFEDKVLSSESRALAREKAL
FEALLENLRENIAHLQMMSSAIAQIDVVANFAHQARLNNWARPEFTPETGIKIQAGRHPV
VEALNKAPFTPNDTFLDAQHRMAIITGPNMGGKSTFMRQTALISLLAYCGSYVPAKTAKL
GPIDRIFTRIGSADDLSTGKSTFMVEMTETSQILHHATNQSLVLMDEVGRGTSTYDGLSL
AWACVVDLTKRVKCLCLFATHYFELTELGSEAGIDNYHVTAQELNGNLILLHKVQQGPAS
QSHGLQVAKLAGIPANVIKEAQKRLRILEKQQQQHLQTSFQNDLFAPPDANSGSQIIEKV
VEIEVSSPALDLLKQIEVDNLSPRQALEQLYELKAALKS
NT seq 2640 nt   +upstreamnt  +downstreamnt
atgaatagcgctgaaatcatggctgatctctccacccacactccaatgatgcagcaatat
ctcaaggttaaaaaagactatcaacatgcgttgctgttttatcgtatgggcgacttttat
gaactcttctttgaagatgcccatttagcagctaaacttttaggtattaccttaacccat
cgtggtaaagcaaacggcaacccgattccaatggcaggcgttccctatcattcggcagaa
ggttatcttgcacgtcttgtcaaagctgggcgaactgtagccatttgcgaacaagtcgga
gaagtgacaggtaaaggtccggttgatcgtaaagttgttcgtattcttacacctggtact
ttaactgatgatgcattactcagcagttatcaatcgtctaatctcgtttcattatgcatt
catcaaaaccagattggtttcgcgttactcgacttaagtgcaggtatttttaaagttcaa
caacaagattacaagccagaacaattacctattgaacttgcgcgtttaatgccaagtgaa
atcttgattgatgaagacttggtcgacacaaatattatcgagcaaattaaaaaacactta
gaatgccctgttaccaaacgtccaaatgtagacttcaatctaaataacgcacaaaaaact
ttatgtgaccaatttacggtatcaacactttcaggttttggtttagacccattaccttta
gctaaagctgctgccgctgcactcattcactatgcaaaagaaacacaaaaaactgcatta
ccgcatatccgttcaattcagcttgagcaaagtacagactttatagcgctcgacccaatc
acacgccgtaacctagaaattatcgaaccgttatttgaacatggcacctcattattccaa
ctggtaaatgactgccaaactgcaatgggtggtcgtttattaagccgcacactcatgcaa
cctgttcgtgatacagccttgctcgatgctcgtttagatgcgattgaacaactcattcag
ggctatcacgaaagtccagttcgtttagtgcttaaagaaattggtgatattgaacgtgtg
cttagccgtgttgcactaggcagtgcgcgaccacgcgatttagttcagcttcgtcatgca
tgtgcacaaattccagctttaagaacagcgttaactccagtcattcaagcgaaaaaatcc
aagttattagttcaacttgatcaagaacttggagattttaaagcacttcatcagcatttg
atggcagcaattgttgaaaatccgccagtattacttcgtgatggcaatgtaattgcagaa
ggatatgatgccgacctcgatgaattacgccaaattcgtgatcatgcaggtcagttccta
attgatttagaaattaaagaacgcgagcgcacaggtattaacacccttaaaatcggctat
aaccgtgtaagtggttactacatcgaattgactcgtgctcaagcagaacaagcccctgct
gactatatccgacgtcaaacattaaagaatgctgagcgctacattacgccagagctgaaa
agttttgaagataaagttctgtcgagtgagtcgcgcgcattagcacgtgaaaaagcatta
ttcgaagctttgcttgaaaaccttcgtgaaaatattgctcacttacaaatgatgagttcg
gcaattgctcaaattgatgtggtggcaaactttgctcatcaagcacgtctaaacaattgg
gcacgtcctgaatttaccccagaaacgggcattaaaattcaggcgggtcgtcaccctgtg
gttgaagcattaaataaagcaccatttaccccaaatgatactttccttgatgctcagcac
cgtatggcaattattaccggtccaaacatgggtggtaaatcaaccttcatgcgtcaaacc
gcattaattagtttacttgcttattgcggtagctatgttcctgctaaaacagccaagctt
ggtccaattgaccgaattttcactcgtattggttcagcggatgatttatctacaggcaaa
tctacttttatggttgagatgacagaaacttcgcaaattctgcaccatgccaccaatcaa
tcgcttgttttaatggatgaggttggccgcggaaccagtacttatgacggtttatcttta
gcatgggcttgcgtggttgatttaacaaagcgcgtaaaatgtttatgcttatttgccact
cactatttcgagttaactgaacttggtagtgaagcaggaattgataactatcatgtgacg
gcgcaagagcttaacggcaacctgattttattgcataaggttcagcaaggccctgcaagt
caaagtcatggtttacaagtcgcaaaattagcgggcattcctgccaatgttattaaagaa
gcacagaagcgtttacgcattttggaaaaacagcagcagcaacatctacaaaccagtttt
caaaatgatttgtttgctccaccagatgcaaactctggttcacaaatcatagaaaaagtt
gtcgagatcgaagtttcatcccctgctctagatttacttaagcaaattgaagtcgataac
ttatcgcctcgtcaggcacttgaacaactctatgagctgaaagctgcgctgaaatcttaa

DBGET integrated database retrieval system