KEGG   Acinetobacter oleivorans: AOLE_13240
Entry
AOLE_13240        CDS       T01263                                 
Symbol
xseA
Name
(GenBank) exodeoxyribonuclease VII large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AOLE_13240 (xseA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_13240 (xseA)
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     AOLE_13240 (xseA)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     AOLE_13240 (xseA)
SSDB
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 Rit1_C
Other DBs
NCBI-ProteinID: ADI91535
UniProt: D8JNI2
LinkDB
Position
2821160..2822425
AA seq 421 aa
MSEPQFSLSEYLGTVQEVIRLAFDEPVWVKAEIRNLNIKGGHYYLELAEKDAKTDKVIAN
CKATIWKFSASKIVLKFERETGIEISSDLNVLIKIRARFDPQYGFSVNIEEIDSSFTLGE
IAKRYQQIIERLTQEGLIHKNKLLPTPFDIQNVLVIAPQNAAGLGDFKKDADALERNGVC
HFVYHTATFQGNTAATSLIESLGSGLRQWASTFKFPPDLIVIIRGGGSVNDLAYLNDYEL
AALLCKRTVPIWVGIGHEKDRTILDEIAHRSFDTPSKVIAGIRNHIVERVQEAVDSLQTI
KLLSQHQITTYQSKNDQLLHQIKSSAQGQLNSAHRLLDQMKERIQFSSQQQVKFSLTQIE
SLMKEVLLQNPKQVQAKGYAIVRSEGKAIRSIHQISNPAIAIEMQDGVIEANITQVIPNE
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtctgaacctcagttttcccttagtgaatatctcggcacagttcaggaagtcatacgt
ttggcttttgatgagccagtctgggtaaaagcagagattcgaaatttaaatattaaaggc
ggccattactatttagagcttgcagaaaaagatgcaaagactgataaagtcattgccaat
tgtaaagctacgatctggaagttctcagcgagtaaaattgttttaaagtttgaacgtgaa
actggtattgagatttcaagcgacttaaatgtgcttatcaaaattagagcacgttttgat
cctcaatatggattttcggtcaatattgaagagattgattcaagctttaccttaggtgaa
attgctaaacgttatcagcaaattattgaacgcctcacacaagaagggttaattcataag
aacaaactcctgcctactccttttgacattcaaaatgttttagtgattgctcctcaaaat
gctgcgggcctaggtgactttaaaaaagatgccgatgctttagagagaaatggtgtttgc
cattttgtgtatcataccgctacgtttcaagggaacaccgctgcaactagcttgattgaa
tctttaggttcgggtttaagacaatgggccagcacatttaaatttccaccagaccttatt
gtaattattcgcggtggcggatctgtgaatgatttggcttatttaaatgattatgaactt
gcagccctgctctgcaaacgcactgtaccgatttgggttggtattggtcatgaaaaagac
cgtactattcttgatgaaattgcccatcgttcattcgacacgccaagtaaagtgattgct
ggcatccgtaaccatattgttgaacgcgtacaagaagccgtcgatagtctgcaaaccatt
aagcttctttcgcagcatcaaatcacgacttatcaaagcaagaatgatcagctacttcat
cagattaaatcttcggcgcaaggtcaacttaactcggcacatcgcctacttgaccaaatg
aaagagcgtattcagtttagttcacagcaacaggttaaattttcattaactcaaatcgaa
tcattaatgaaagaagtccttttacaaaatccgaaacaagttcaagccaaaggctatgca
attgttagatccgaaggaaaagcgattcggtctatacatcaaatttcaaaccctgccatt
gcgattgaaatgcaagatggtgtgattgaagccaacattacacaggtaattccaaatgaa
caatga

KEGG   Acinetobacter oleivorans: AOLE_13245
Entry
AOLE_13245        CDS       T01263                                 
Name
(GenBank) hypothetical protein
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AOLE_13245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_13245
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     AOLE_13245
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     AOLE_13245
SSDB
Motif
Pfam: Exonuc_VII_S RusA
Other DBs
NCBI-ProteinID: ADI91536
UniProt: D8JNI3
LinkDB
Position
2822415..2822609
AA seq 64 aa
MNNEELTFKDGHDILKKNAELLESQESPDIDNLMKIVEESITAYKACKSRIEAVQQALDE
TFKE
NT seq 195 nt   +upstreamnt  +downstreamnt
atgaacaatgaagagttaacgtttaaagacggccatgacattttgaaaaaaaatgcagaa
ctacttgagtctcaagaaagcccagatattgataatttaatgaagattgttgaagagtcg
attactgcttataaagcatgtaaatcccgtatagaagccgttcaacaagctttagatgaa
acatttaaagaataa

DBGET integrated database retrieval system