KEGG   Acinetobacter oleivorans: AOLE_13575
Entry
AOLE_13575        CDS       T01263                                 
Symbol
rnhB
Name
(GenBank) ribonuclease HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_13575 (rnhB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_13575 (rnhB)
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     AOLE_13575 (rnhB)
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     AOLE_13575 (rnhB)
   Elongation factors (archaeal)
     AOLE_13575 (rnhB)
SSDB
Motif
Pfam: RNase_HII
Other DBs
NCBI-ProteinID: ADI91602
UniProt: D8JP28
LinkDB
Position
complement(2893516..2894082)
AA seq 188 aa
MFIAGVDEAGRGPLVGSVVAAAVILDPNNPIEGLNDSKKLTEKKREKLFIEIQEKALAWS
IAEATHAEIDELNILQATFLAMQRAVDGLKAQPQKVIVDGNQIPKGIIIPCEAIVGGDAS
HPEISAASILAKVTRDRQMAELDQQYPLFGFAKHKGYPTKAHFEAIATHGVIDQHRRSYA
PVKRALGL
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtttattgctggtgtagatgaggcgggacgtggtccgttagtaggttccgttgtggca
gcggctgttattttagatccgaataatccaattgagggattaaatgattctaaaaaatta
actgaaaagaaacgtgaaaagttgtttattgaaatacaagaaaaagccttagcttggtca
attgcagaagcaacgcatgctgaaatcgatgaattaaatattttacaagcgacttttttg
gccatgcagcgcgcagttgatggtttaaaagctcaaccacaaaaagtgattgtagatgga
aatcaaattccaaaaggaatcattattccttgtgaagctattgttgggggggatgcgagt
catcctgagatcagtgcggcgagtattctggcaaaggttacacgtgaccgacaaatggca
gaattagatcagcaatatccattatttggttttgccaaacataaaggatatccaactaaa
gcacattttgaagcaattgcaacgcatggggtaatcgatcagcaccgccgcagctatgct
cctgttaaacgtgctctaggcttataa

DBGET integrated database retrieval system