KEGG   Acinetobacter oleivorans: AOLE_14070
Entry
AOLE_14070        CDS       T01263                                 
Name
(GenBank) bifunctional ribonuclease HI/DNA polymerase III subunit epsilon
  KO
K14159  ribonuclease HI / DNA polymerase III subunit epsilon [EC:3.1.26.4 2.7.7.7]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03430  Mismatch repair
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_14070
   03430 Mismatch repair
    AOLE_14070
   03440 Homologous recombination
    AOLE_14070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_14070
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_14070
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AOLE_14070
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     AOLE_14070
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AOLE_14070
    RNase H
     AOLE_14070
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AOLE_14070
SSDB
Motif
Pfam: RNase_H RNase_T Rv2179c-like DNA_pol_A_exo1 RVT_3
Other DBs
NCBI-ProteinID: ADI91701
UniProt: D8JPC7
LinkDB
Position
3011272..3012648
AA seq 458 aa
MSQTITLYVDGACRGNPGLGGWGAYVITEQGEHKLFGGEPETTNNRMELTAAIEGVSFCP
PDAHLIIWTDSNYVKQGITEWIHGWKKKNWKDVKNPDLWQKLDAVCAGRNIEWNWIKGHA
GHAGNEMADELANIGADQTALQKKTVQATALQDIKKPEEDWLLDDPFGFDMAEVAEEDNI
DLEQPEEVEMIIVEEEVIEVEAAEPESKQSINNIHPQIVVTEAKLQLQGPRQLILDTETT
GFYFQDGDRIIEVGAIEMINRKLTGSSIHIYINPQKPVGDSENIHGISDNFLKDKPLYAE
IADTLFDYLKGAEIIAHNATFDMNFLDMEFRRAGLPALSEVCEVTDTLALAKSKHPGQKN
SLDALVRRYEIPARDRTFHGALLDAEILSDVYLAMTGGQVSFDIDALSQSENSQNTTNKT
RIQIDLPVIYPSEEELNTHETWVKEFEKKHGEPCLFAK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgtctcaaacaatcacactgtatgttgatggtgcatgtcgtggcaatccgggtttaggt
ggttggggcgcatatgtcattaccgagcagggtgagcataaattatttggcggtgaacct
gagacaaccaataaccgtatggagcttactgctgcgattgagggtgtttcattttgccca
cccgatgctcacttaattatctggacagattcaaattatgtgaagcaaggcattactgaa
tggattcatggctggaaaaagaaaaactggaaagatgtaaaaaatcctgacctttggcaa
aaattagatgctgtatgtgcaggtagaaatattgagtggaactggattaaaggccatgct
ggacatgcaggcaacgaaatggccgatgagcttgcaaatatcggagccgatcaaaccgca
cttcaaaaaaaaacagttcaagcgactgctctgcaagatataaaaaagcctgaagaggat
tggttgcttgatgacccttttgggtttgatatggcagaagtagccgaagaagataatatt
gatcttgaacagcccgaagaagttgagatgattattgtggaagaagaagttattgaagtt
gaagctgctgaaccagaaagtaagcaatccattaataatattcatcctcaaattgttgtg
actgaagccaaattacaattacaagggcctcgacaactgattctcgatacggaaaccact
ggtttttatttccaagatggcgaccgaattattgaggtgggcgctattgaaatgattaac
cggaaacttaccggtagctcaattcatatttatattaacccgcaaaaaccagtgggtgac
tcagaaaatatccatggtatcagtgataatttcttaaaagataaaccgctctatgcggaa
attgccgacacgctctttgattatctaaaaggcgcagagattattgcgcataacgcaacc
ttcgatatgaacttcctagatatggagtttagacgcgctggccttcccgcgctttccgaa
gtatgtgaggtaacagatacgttagctttagcaaaaagcaaacatcctggacaaaaaaac
tcgcttgatgctcttgtaagacgttatgaaattccagcacgtgaccgtaccttccacggt
gcattactcgatgctgaaattctttcagacgtttacctagcaatgacaggtggacaggtt
tcttttgatatagatgccttatcccaaagtgaaaatagccagaacacaacaaataaaact
aggattcaaattgacctaccagttatttacccttctgaagaagagctaaatacacatgag
acttgggtcaaagaatttgagaaaaaacatggagaaccttgcctttttgcaaaataa

DBGET integrated database retrieval system