KEGG   Acinetobacter oleivorans: AOLE_14865
Entry
AOLE_14865        CDS       T01263                                 
Name
(GenBank) DNA adenine methylase
  KO
K06223  DNA adenine methylase [EC:2.1.1.72]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AOLE_14865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_14865
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_14865
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:acd02048]
    AOLE_14865
Enzymes [BR:acd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     AOLE_14865
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    AOLE_14865
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     AOLE_14865
Prokaryotic defense system [BR:acd02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    AOLE_14865
SSDB
Motif
Pfam: MethyltransfD12 Cons_hypoth95 PTR2
Other DBs
NCBI-ProteinID: ADI91860
UniProt: D8JEH8
LinkDB
Position
complement(3181501..3182301)
AA seq 266 aa
MNPFLAWTGGKRWLGKVAPELFNIDFSGKYIEPFLGGASFFYALQPKKSILGDTNKDLII
TYRAVRDHHLEVVNLLKNHHKKHCKEYYYLIRDQIFDNEVEIAAQFIYLNRTCFNSIYRV
NLKGKFNVPIGTKTNVIQDQDRWEEWSKSLKNAELVCGDFENLINKAKKNDLLFLDPPYT
VRHNNNGFIKYNEVLFSWADQERLAKAAENAQKKGVKIIITNANHESIRELYSSSFNIKE
ISRYSSIAANGTNRNKYEELIITCNI
NT seq 801 nt   +upstreamnt  +downstreamnt
atgaatccttttttagcttggactggtggaaagcggtggttaggaaaagttgctccagaa
ctttttaacattgattttagtgggaaatatattgagccatttttaggtggcgctagtttt
ttttatgctttacagccaaagaaaagtatattaggagacactaataaagatctaattatt
acttatagagctgtaagagatcatcatttagaagtagtaaacttattaaaaaatcatcat
aagaaacattgtaaagaatattattatttaatacgagatcaaatttttgataatgaagta
gaaattgcagctcaatttatttatttaaatagaacctgttttaacagtatttatagagta
aatttaaagggaaaatttaatgtacctattggtactaaaacgaatgtaatacaagatcaa
gatagatgggaagaatggtctaaaagcctaaaaaatgctgagttagtatgtggggatttt
gaaaatcttattaataaagccaaaaaaaatgatctactttttttggaccctccttatact
gttagacacaataataatggctttataaaatacaatgaagttctattctcatgggcagat
caagaaagattagcaaaggctgcagaaaacgctcaaaaaaagggtgtaaaaattataatt
acaaatgctaatcatgaatctataagagaattatatagttcttctttcaatattaaagaa
atatctagatatagtagtattgccgcaaatggtactaatcgtaataaatatgaagagtta
ataattacatgtaatatatga

KEGG   Acinetobacter oleivorans: AOLE_15050
Entry
AOLE_15050        CDS       T01263                                 
Name
(GenBank) site-specific DNA methylase
  KO
K06223  DNA adenine methylase [EC:2.1.1.72]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AOLE_15050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_15050
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_15050
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:acd02048]
    AOLE_15050
Enzymes [BR:acd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     AOLE_15050
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    AOLE_15050
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     AOLE_15050
Prokaryotic defense system [BR:acd02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    AOLE_15050
SSDB
Motif
Pfam: MethyltransfD12
Other DBs
NCBI-ProteinID: ADI91897
UniProt: D8JEL5
LinkDB
Position
complement(3210912..3211682)
AA seq 256 aa
MKSKPIIPWQGGKSRLAKDLLSRFPEHSCYVELFCGGAALFFLREDPAKTEVINDLNGEL
VNLYRVVQNHLEEFVRQFKWCISSRQIFEWENLKVPDTLTDIQRAARFYYLQQHAFGGRV
SGQSFGYGTTGRSFNLLRIEEFLSSAHLRLNGVYIENQSWDKCFDRYDREHTFFYADPPY
LDTAGYGVDFSIDQYELLSEKMNNCKGKVMLSINDHEKIREIFKGFNFAVTSINYSVCRD
VAAKSKKSNELIIMNY
NT seq 771 nt   +upstreamnt  +downstreamnt
atgaaatcaaaaccaataattccatggcagggtggtaaaagccgtttagctaaggatttg
ttgagtcgattccctgaacattcatgttatgtggaattattttgcggtggtgctgcattg
ttctttttaagagaagatccggcaaagacagaggttataaacgatttaaatggtgagttg
gtaaatctctatcgagttgttcagaaccatcttgaggaatttgtacggcaatttaaatgg
tgtatttcgagccgccaaatatttgaatgggaaaatttaaaagtaccagacacattaact
gatatacaaagagctgcaagattttattatcttcagcagcatgcttttggtggtagagtt
tctggtcaaagttttggatatggtacaacaggacgttcatttaaccttttaaggattgaa
gaatttttaagttctgcccatttgcgtttaaatggcgtttatattgagaatcaatcttgg
gataagtgctttgatcggtatgacagggaacacactttcttttatgcggatccaccttac
cttgatactgctggatatggtgtggatttttcgattgatcaatatgagctgctttctgag
aagatgaataattgcaaagggaaggtgatgctgtcaattaatgaccatgaaaagattcgt
gagatctttaagggttttaattttgcagttacttcaattaattactctgtttgtcgtgac
gtggcagcaaagagtaaaaaaagcaatgaactaataattatgaattattag

DBGET integrated database retrieval system