KEGG   Acinetobacter oleivorans: AOLE_15665
Entry
AOLE_15665        CDS       T01263                                 
Name
(GenBank) DNA ligase, NAD-dependent
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03030  DNA replication
acd03410  Base excision repair
acd03420  Nucleotide excision repair
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AOLE_15665
   03410 Base excision repair
    AOLE_15665
   03420 Nucleotide excision repair
    AOLE_15665
   03430 Mismatch repair
    AOLE_15665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:acd03032]
    AOLE_15665
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_15665
Enzymes [BR:acd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     AOLE_15665
DNA replication proteins [BR:acd03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     AOLE_15665
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     AOLE_15665
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AOLE_15665
   MMR (mismatch excision repair)
    DNA ligase
     AOLE_15665
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AOLE_15665
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD PTCB-BRCT HHH 5_3_exonuc FmiP_Thoc5
Other DBs
NCBI-ProteinID: ADI92020
UniProt: D8JFC4
LinkDB
Position
complement(3330028..3332067)
AA seq 679 aa
MATTSVIEQMRQLIQLIAKHNHAYYVMDQPTISDSEYDHLFHQLKALEEQYPDQVQSDSP
TTKVGGQALSKFQSVTHVVPMLSLGNVFNQEDLFAFARRVEERLPNQKVQYEVELKLDGL
AISLWYENGVLIRGVTRGDGETGEDITQNVKTIRNLPKVLHSDHFEIPRLLEVRGEVLMP
KSGFEKLNADQEAKGEKTFANPRNAAAGSLRQLDPNIAASRPLAFYAYGIAQCEPNHNLT
TMHDSLQWLTQLGFEIAERQYLCNSIQEVQQRYEQIQQERPDLQVEIDGMVVKVDDLKQQ
QQLGFLSREPRWATAYKFPAQAALTTVDQIDWQVGRTGTLTPVARLNPVFVGGVTVSNVT
LHNIGEIHRLDVRVGDTVSVYRTGDVIPKVEKVWPEFRSPEAEIVHLPESCPVCASPVVM
PEGEALARCSGGLYCAAQRIEAIRHFVSRKALDIEGLGDRWVESLLHLDLLKDVADIYHL
HEHRETLLGIEKMGEKSVQNLIDAIEASKKTTLARFIYALGIRGVGETTARMLANTFQTL
EALKAADVEALKKTPDVGDITAEWIADFFLAPHNIEVLDRLIAAGIHWDAPTAPTRQPLN
GESWVLTGTLEQMTRDQATQMLQALGARVSGSVSSKTKCVVAGEKAGSKLEKAAKLGIAV
MNETDFLSLMASYGQTLSE
NT seq 2040 nt   +upstreamnt  +downstreamnt
atggcaacaacttccgtgatcgaacagatgcgtcagcttattcaactgattgcaaagcat
aaccacgcctattatgtgatggatcagccgacaatctcggacagtgaatatgatcattta
tttcaccagttaaaagctttagaagagcaatatcctgatcaggttcaatcagattctcca
acgacaaaggtaggcggccaagcactctctaaatttcaaagtgtgactcatgtcgttccg
atgctttctttggggaatgtttttaatcaggaagacttatttgcatttgctcgccgtgtt
gaagagcgtttgcctaaccaaaaagtacaatatgaagtagaactaaaacttgatggtctt
gcgatttcgctttggtatgaaaacggtgtgttaatacgtggtgttacacgtggtgacggc
gaaactggagaagacattacccaaaacgtcaaaacgattcgtaacttgcctaaagtgttg
cattcagatcactttgaaattccacgtttgcttgaagtccgcggtgaagtgctcatgcca
aagtctggctttgaaaaacttaatgccgatcaggaagcaaaaggtgagaaaacgtttgcg
aacccacgtaatgccgcagcaggtagtttaagacagctcgacccgaatattgctgctagt
agacctttagcgttttatgcgtatggtattgcccagtgcgaaccaaatcataacttaacc
accatgcacgacagcctgcaatggctcacacaacttggatttgaaattgctgagcgtcaa
tatctatgtaattcaattcaagaagtacagcagcgttatgagcaaatccaacaagaacgt
ccagatctacaagttgaaattgatggaatggtcgtaaaggttgatgacttaaaacaacaa
caacaacttggtttcttaagtcgtgagccacgttgggcaactgcttataaatttcctgca
caagctgcattaactacagttgatcagattgattggcaagtagggcgtacaggtacttta
acccctgtagcgcgtttaaaccctgtatttgtagggggagtaacggtttccaacgtaact
ttacataacattggtgaaatccatcgtctagatgtgcgtgttggcgatactgttagtgtt
tatcgtacgggcgatgttattcctaaagtagaaaaagtttggccagaattccgttcacct
gaagctgaaattgtacatttgcctgaaagctgtcctgtttgtgcctcaccagttgtaatg
cctgaaggagaagctttagcacgttgttctggtggactttattgtgctgcacagcgaatt
gaagcgattcgccattttgtatcacgtaaagctctggatattgaaggtttaggagaccgc
tgggtagagtctttattacacctcgatttacttaaagatgttgccgacatttaccatttg
catgagcaccgagaaactttgctcggtattgaaaaaatgggtgagaaatcggtacaaaat
ctcattgatgccattgaagccagtaagaagacaacgcttgcacgttttatttatgctctg
ggaattcgtggagtgggtgaaacaacagctagaatgttggccaatactttccaaacttta
gaagcacttaaagctgctgatgttgaagctttaaagaaaaccccagatgtcggtgatatt
actgcagagtggattgctgactttttcttggcaccgcacaatattgaagtacttgatcgc
ttaattgcagccgggattcattgggatgcgccaacagctccaacacgtcagccgttaaat
ggtgaaagctgggtattaacaggcacattagaacaaatgacccgtgatcaggcgactcaa
atgctacaagcattaggtgcgcgtgtaagcggtagtgtatcgagtaaaaccaaatgcgtc
gttgcgggcgagaaggctggttcgaaattagaaaaagcagcaaaacttggtattgctgtt
atgaatgagactgatttcttatcacttatggcgagctacgggcagactttaagcgaatag

DBGET integrated database retrieval system