KEGG   Acinetobacter oleivorans: AOLE_17220
Entry
AOLE_17220        CDS       T01263                                 
Name
(GenBank) putative ATP-dependent DNA helicase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03420  Nucleotide excision repair
acd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    AOLE_17220
   03430 Mismatch repair
    AOLE_17220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_17220
Enzymes [BR:acd01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     AOLE_17220
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AOLE_17220
   MMR (mismatch excision repair)
    Other MMR factors
     AOLE_17220
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 Viral_helicase1 UvrD_C_2 AAA_30 AAA_12
Other DBs
NCBI-ProteinID: ADI92329
UniProt: D8JGZ7
LinkDB
Position
complement(3663997..3665976)
AA seq 659 aa
MSLAKLINELNAQQKKAATTSAQNCLVLAGAGCGKTKTIVARAAYLIDQGLPANQIQILT
FTRRAASEIVARVEQHVGAQAKGLRASTFHTFCMYLLRRNPQAFGLNQFSIIDRDDQLLM
FRLLRGKDKDNVLPKAAELCDLYSYARNTQTKLSEALIKQLPDAYEHKNQIADLMKTYEQ
RKRERNFLDYDDILSIVAVHLQNSEALTNWVAGFCQALLVDEMQDTNPLQWALLQPLIGK
VKLFCVGDDAQSIYGFRGADFENIHSFKERIPDAVIHTLDLNYRSTQEILDLSNWLLAHS
PIDYQKQLQAHRGQGQKPQLHLFGNEYEEANWIAQDLITRHQQGASWYDHMVLVRSGYSA
RYLEGAFIAAEVPYRFIGGVKLLESAHVKDVLSLLRIVSNPHDDLAWMRFLTLWDGIGDV
GASKLAQELMGIVDVEERCNRLERHGKVPLQAILILKQLDVLQQHVEASIGLALDALGEQ
LEQNYKTKDWSRRLKDFDLVKQLARKHASLGEFLEEYVLEPISVSEIEKAADQDLVTLIT
IHSAKGAEQKVCYVPHVSPNQYPYARAQGDFDDVEEERRVLYVALTRAENELILTKQNLN
TWSEDNYDEQGRKIESYFLNDLPAHLVQAKIHRQVPQPFAKKQWSRSPTVNLGFGIDLD
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgagtcttgcaaaattaattaatgaactaaatgctcagcaaaaaaaagcagccactacg
tctgcgcaaaactgtttagttttggcgggcgctggttgtggcaagactaaaactattgtt
gctcgtgcagcttatttaattgatcagggcttgccagcgaaccaaatccagattttaacg
ttcacgcgccgtgctgcgagtgaaattgttgcgagagtagaacaacatgtgggagcacag
gcaaagggtctgcgagcttcaacttttcatacgttttgtatgtatttactacgccgtaat
ccacaagcttttgggttaaatcaatttagtattattgatcgtgatgatcagttgcttatg
tttcgcttattaagaggcaaagataaagataacgtcttgcccaaagccgcagagctgtgt
gatttatattcttatgcgagaaatactcaaacaaagctttctgaggcattaattaaacag
cttccagatgcatatgagcataagaatcaaattgcagatttaatgaaaacctatgagcag
cgtaaacgagagcgtaattttttagattacgacgatatcttgtcaattgtggctgttcat
ttacaaaattcagaagcattaacgaattgggtggcaggtttttgtcaggcattgctagtt
gatgaaatgcaagataccaatcctttgcaatgggctttattgcaaccattgattggcaaa
gtgaagctattttgtgttggcgatgatgcccagtcgatttatggttttcgcggtgcagac
tttgaaaatatccattcttttaaagagcggatacccgacgcagttattcatacactggat
ttaaattatcgttcgactcaagaaatcttggatttatcaaactggttgttagcacacagt
ccaattgattatcaaaaacagctgcaagcacatcgtgggcaaggacaaaagcctcagttg
cacctatttggtaatgagtatgaagaagcaaactggattgcacaggacttaataacgcga
catcagcaaggtgcaagctggtacgaccatatggttttggtccgttctggctatagtgca
cgatatctggaaggggctttcattgctgcggaagtaccttatcgttttattggtggggta
aaacttcttgaatctgcacacgtgaaagacgtgcttagcttgttacgtattgtgagcaat
cctcacgatgatttggcgtggatgcgttttttaaccttgtgggatggtattggtgacgtt
ggtgcaagtaagctcgcgcaagagttgatgggaattgttgacgttgaagagcgctgcaac
cgtctagaacgtcatgggaaagtccctttacaagcgattttaattttaaaacagctagat
gtattacagcagcatgtggaagcaagcattggcttggcactcgatgctttaggtgaacaa
ctagagcaaaattataaaactaaagattggtcacgccgattaaaagactttgacttggtt
aagcaacttgcgcgtaaacatgcatctttaggtgagttcctcgaagaatatgttcttgaa
cctatttcagtttctgaaattgagaaagcagctgatcaggatttagtgactttaattacg
attcattcagctaaaggtgccgaacagaaagtttgctatgtacctcatgtatcgccaaat
caatatccttatgcaagggcacagggcgattttgatgatgtcgaggaagagcgccgcgta
ttgtatgttgcattaacacgtgcagagaatgaattaattttgaccaagcaaaatctcaat
acatggtcagaagacaattatgatgaacaaggtcgtaaaatcgaaagttatttcctaaat
gatcttcctgcacatttagttcaagcaaagattcataggcaagtacctcagccatttgct
aaaaagcaatggagccgttcacctacagtaaatttaggttttggtatcgatctagattaa

DBGET integrated database retrieval system