KEGG   Acinetobacter oleivorans: AOLE_17590
Entry
AOLE_17590        CDS       T01263                                 
Name
(GenBank) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:5.6.2.4]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_17590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_17590
Enzymes [BR:acd01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     AOLE_17590
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOLE_17590
SSDB
Motif
Pfam: PriA_C PriA_3primeBD ResIII DEAD Helicase_C AAA_30 zinc-ribbons_6 PIF1 T2SSE PriA_CRR TrwB_AAD_bind AAA_19 AAA_11 PolC_DP2
Other DBs
NCBI-ProteinID: ADI92403
UniProt: D8JHK7
LinkDB
Position
3742246..3744474
AA seq 742 aa
MTITPKPDSVVYRVRVAVPVHLYDTFDYTLTQAQYERAHVGSRVAISFGRQNLIGIITEK
VNPHEPFTGKFQLKAISELLDEEPILDEQVLSLLTWSAQYYQFPIGEVMQTALPALLRQG
KPMDVLFHLWKITPCDNVEALLKRSVKQQDAYQILKLHPAGTTENILNLSGVETATLKAL
QKKGLVDCTLEPHDFSPTPAQLAQMPLTLNEDQKKATQHVVNAQHQYQAFLLDGLTGSGK
TEVYLHIMHEVLKRGKQVLVLVPEIGLTPQTISRFKSRFNCDIALLHSGLNDSKRLQAWQ
QAQTGKASIILGTRSAIYTPLPRLGLIILDEEHDLSYKQQEGFRYHARDVALYRGHLQSC
PVILGSATPSIDSYYLVETGKLTTLQLNKRAGHALLPKMHLIDLKIVKKQHGISQPLIEQ
IKHTLARKEQVLIFLNRRGYAPVLVCESCGWQANCPHCDAHFTLHTQPYSYLHCHHCGTI
HRLPDHCPECQQKSLKTLGAGTAKVEEHLQELFPDHDVIRVDRDSTSRVGSWQKIYDRIH
QNKPTILLGTQMLAKGHHFPHVTLVAILDIDAGLLSVDIRAPERTAQLIVQVAGRAGRGE
HKGHVYLQTLRPDHPLLTTLIEKDYRAVAKQTLAERKVALLPPYRYAVLIRAESKDRDYT
LQFLNEAAEQLRQVAGEIVDIWGPIPAPMERKAGRYRAHMVILSADRARLHFYLRQWWSQ
LVHAPRQHQLRLSIDVDPQEFN
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgaccataacgccaaagccagattcagttgtttatcgtgtgcgtgtagccgtacctgtg
catctgtacgacacttttgactatacactcacccaagcacaatatgaacgggctcacgta
ggctcacgcgtcgctatttcatttggacgccaaaacctgattggtatcattacagaaaaa
gtaaatccacatgagccatttacaggcaaatttcagcttaaagccatttctgaactttta
gatgaagaaccaattttagatgaacaagttttaagtttattgacatggtccgcgcaatat
taccaatttccaattggtgaggtcatgcaaactgccctacccgcattattgcgtcagggc
aaaccgatggatgttttgttccatctttggaaaatcactccctgtgacaatgttgaagca
ctgctaaagcgttctgttaagcaacaagatgcgtatcaaattttaaaattacaccctgcc
ggaactacagaaaatattctcaatttaagtggtgtagaaactgcaacgcttaaagcactt
caaaagaaaggattggttgactgcacgctcgaaccacacgactttagcccgacaccagct
caattggcacaaatgccgctcacgctcaatgaagatcaaaagaaagcaacccagcacgtc
gtaaatgcacagcatcaataccaagcctttttactagatggcttaactggaagtggtaaa
actgaagtttatctgcacatcatgcacgaagtgctaaagcgaggtaaacaagtactggtg
ttagtacctgaaattggcttaacccctcaaacgatttctcgctttaagtctcgttttaac
tgtgatattgctttattgcattcaggcttaaatgattccaaacgcttacaagcatggcaa
caagcacagaccggaaaagcgtctattattttaggaacgcgctctgccatctatacgcca
ctgccacgtttgggcctcatcattttagatgaagaacacgacctgtcttataagcaacaa
gaaggcttccgatatcatgcgcgtgatgtcgcactgtaccgcggtcacttgcaaagctgc
cctgttattttaggttcagccacaccaagtattgatagttattatttagtcgaaactggc
aaattaactacactgcaactcaacaaacgtgctggacatgcacttttgcctaaaatgcat
ttgattgaccttaaaattgtcaaaaagcagcatggaattagccaaccccttattgaacaa
atcaaacatacattagctagaaaagaacaggttttaatctttttaaaccgtcgtggctat
gcacctgtactggtttgtgaaagctgtggatggcaagcaaattgcccgcattgtgatgcg
cattttactttgcacactcagccttattcttatttacactgccatcactgcggaaccatt
catcgcttacccgatcattgccctgaatgtcagcaaaaaagcttaaaaactttaggtgca
ggaaccgctaaggttgaagagcacttacaagaactatttccagatcatgatgtcattcgg
gtcgatcgtgacagtaccagtcgtgtcggaagctggcaaaaaatttatgatcgcattcat
caaaacaaaccaacaattttgctcggtactcaaatgttggcaaaaggccatcattttcca
catgtcacattagttgccattttagatattgatgcaggtttactcagtgtagacatccgt
gcgccagaacgtacggcgcagctgattgtacaagtcgctggtcgtgcaggtcgtggagaa
cataaaggtcatgtttatttacaaaccttaagacctgatcatccgttacttaccacactc
atcgaaaaagattatcgcgcggttgccaaacaaacgctggctgaacgtaaagttgctttg
ctgccgccttatcgctatgcagttctaatacgagcagaatccaaagatcgtgactatacc
ttacaatttttaaatgaagctgccgagcaacttcgtcaagtcgctggtgagattgttgat
atttggggacctattccagcgccgatggaacgtaaagcgggacgctaccgtgcccacatg
gtaattttatctgccgaccgtgctcgcctacatttttacttaagacaatggtggtctcaa
ttggttcatgccccaagacagcatcaactcaggctatcaattgatgtcgatccgcaagaa
tttaattag

DBGET integrated database retrieval system