KEGG   Acinetobacter oleivorans: AOLE_17640
Entry
AOLE_17640        CDS       T01263                                 
Name
(GenBank) exonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_17640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_17640
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AOLE_17640
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOLE_17640
SSDB
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD SH3_13 Viral_helicase1 AAA_11 DUF2075 UvrD-helicase AAA_22 PhoH ResIII Herpes_Helicase T2SSE AAA AAA_16 Flavi_DEAD DEAD AAA_28 AAA_24
Other DBs
NCBI-ProteinID: ADI92413
UniProt: D8JHL7
LinkDB
Position
complement(3755978..3757729)
AA seq 583 aa
MDNLNSSEQADLSWLTTWSNFLNQAPFTEQSQGSEATSYLQQLIEASLQGDSCIDVSSEQ
IAALGQLAISADQATSNVAPCVYDEQGLALYRYWHLEQRLAEQICRLKQQLIQPVSCDDY
LDLLTDPHQQAALQMVARQSLSIITGGPGTGKTYTLARIIAVLSQTIPNIRVAMAAPTGK
AAQRMQEALQNSFNDPKLLESGLVSEELRNQGTQTIHRLLGMGHSQTPRFNQKQPLPYDV
IVVDEASMLDLNLATLLLEAVPESCRIILLGDANQLASVDVGAVLADLQQIQALAANRVQ
LQTSRRFAEGALIGQVARFIQMRTSQINHEQVLQQFEIDIVEVSELKPIVLQSDMPDVVQ
LEYLPEGNHAEVEIYYQKLMLGFQGYVKSLKNYLKEERSIEQVQNVVKAFDDYRILTAVR
HGPFGLQQLNQYAQRWIQQQLSIVVAGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQ
PQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELI
YTAITRAKKVVSLLVHPEALLQSFTIRTTRKSGLVQKVNRLVR
NT seq 1752 nt   +upstreamnt  +downstreamnt
gtggacaatctaaatagctctgaacaggccgatttaagctggttaacaacgtggagtaac
ttcttaaatcaggctccatttactgagcaatcgcaagggtcagaagccacttcttacttg
cagcagcttattgaagcgagcttacaaggcgatagctgtatcgatgtcagttctgagcaa
attgcagcacttggtcagcttgctatatctgccgatcaagcaacttcaaatgttgcccca
tgcgtctatgatgagcaggggttggcattataccgatattggcacctagagcaacgactt
gcagaacaaatttgtcgattaaagcaacaattaattcaacctgtatcttgtgatgactac
ttagacctactcacagacccgcatcaacaggcagctttacaaatggttgctcggcagagc
ctgagtattattacgggtgggccaggtacgggtaagacctatacgcttgcacgtattatt
gcagtgcttagccaaacaattccgaatattcgtgtggcgatggctgctccaacaggtaaa
gccgcacagcgcatgcaagaggccttacagaactcatttaatgaccctaaattgcttgag
tctggattagtgagtgaagaactaaggaatcagggaacgcaaacaattcaccgattattg
gggatgggacatagtcaaacaccacggtttaatcaaaaacaaccgcttccttatgacgtg
attgttgtggatgaggcttccatgctggatttaaatctagctactcttctacttgaagca
gtgccagagtcttgtcgaattattttattaggagatgcaaatcagctggcttccgtcgac
gtcggagcggttcttgctgacttgcaacaaatacaggcactcgccgctaacagagtacaa
ttacaaaccagtcgccgttttgctgaaggtgcattgattgggcaggtggcacgttttatt
caaatgcgaaccagtcagatcaatcatgagcaggttttgcaacagtttgaaattgatatt
gttgaggtttctgaattaaagcctatagttttacaaagtgacatgccagatgtggttcag
cttgagtatttgccagaagggaatcacgcagaagtcgaaatttattatcagaagctcatg
ctcggtttccaaggatatgtaaaaagcctaaaaaattatttaaaagaagaacgctctatt
gaacaggtccaaaacgtagtaaaagcatttgatgactaccgtattttaacggctgttcgt
catggtccatttggcttacagcagttaaatcaatatgcgcagcgttggatacagcaacaa
ctttcaatagtggtagctggggggtggtatgtcggtcgtccggtaatgatgacttataac
gactatcagctcggtatttcaaatggtgacattggtctgtgttttgaacacagaactcag
ccacagcaatttgaagtatattttccaagtttgaataaatgggtcgctgcaaatcgatta
cctaaaagtattcaaagtgcattcgctttaacgattcataaatcgcaagggtctgaattt
acacacactgctgtcgttttagatcaagccgcaaagaatttattaagccaagagcttatt
tacactgcgattacacgcgctaaaaaagtagtgagtcttttggttcatcctgaagcttta
ctacagtcctttacaattcgtacgacacgaaaaagtggtttagttcagaaagttaatcga
ttagttcgttaa

DBGET integrated database retrieval system