KEGG   Acinetobacter oleivorans: AOLE_17645
Entry
AOLE_17645        CDS       T01263                                 
Name
(GenBank) ATP-dependent exoDNAse (exonuclease V) beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AOLE_17645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_17645
Enzymes [BR:acd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AOLE_17645
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AOLE_17645
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_25
Other DBs
NCBI-ProteinID: ADI92414
UniProt: D8JHL8
LinkDB
Position
complement(3757838..3761536)
AA seq 1232 aa
MNSRVQVSYQPIIDIEFSGLHLIEASAGTGKTYTLSSLMVRIFLEKYLPRQVIATTFTRA
AAAELKSRIRARLVETYRYLETKRSFTEHELITQAEQEPDLLLQHILKSFATRIAYACER
LKLVIDQLDELFVGTLDSFSQKLLREFAFESGKIERAQITDDAKTYSRQLIHDVLREWIQ
SQPQNVIDALYLAGELKNVDSFVKLVEDSLNFSSAHFKLPEKPNIQFEQLAQLKQLATEI
DLSLLENYYQLDGEHYKHVSGTIFRNGAFNKLFSECLPQLLQVLTQSDSILVFDGSMTAQ
RELVFKFLGQLADQKVFKKCPAEISDGFYQHPCIQQIQQLFGVLKNYAEQFDQLHIFLKA
YLCVEVKKRLPQVLQNKGETTFSQQIRTLSEALKGEQGQRFAVFVQARYPLILVDEFQDT
NQDQDDMLANIWRHPERYQKGCMIMVGDRKQAIYGFRGGDMLTFLNAYKDIQAKHGREYK
LIHNHRSVADLVEVVDALFQRQIDFGEEVQYDPIRAGTRPHPVLIEQNNHNPHPLRWLML
KDKETEAQQVAWKIRDLLNQSHAGQLYFQKDAQTQALNEDDIAVLSRNHDGLDKVQFELE
RLGIRVNRPSKRSVFDCTVAQDVGALLTAILHPYDEAKVKRALISRLFAMDLKQLLQLEQ
TAEGLSQFMTGFDSIRELWSAQGFLVAWQQCLIQFDIWQNLVAAQSKDNERVVVNLRHLT
EILSQHSEKYSGAQNLYHWYLKQLSSPLDRDWELERKLSSEAGVQLMTIHQSKGLEFKIV
FLLGADKPFRENNKTLNFSTQDVVQPDSSQTLTQRVVAIADKTYLNEVELKQHEERALAE
QNRLWYVALTRASHRVYALLQDLDGKSVSGLAFWKNRTEPFQHRCCTDEMVLEQIPQAIH
LAKQTSIIEIQAQRFPEQRFYSRGKTSFSYLAQHLKHKAGTDLLVSQSDDAVLAEDELDL
INTAEAISAQPIDWIKSNFPRGTLAGNFLHEIFEHINFQCSDDWVSEIRRRFKNDYSSLW
QDLLNKYNESFPEQEDAENLLYQSVAEWLKDILRTPLDQSFRLNQLQQEQYLSEFPFYLA
LSDRVLAMTRIQQLFAEYGLNMPELLEARSARYLNGSIDLVYFDGQRYHIADYKSNYLGD
DLADYRSDSIAQSMSLASYWLQAGLYLVALHRYLQVKMQDYQIEQHLGGATYLYLRGMNG
EAEQGYYYWQPSIEFILRLDAILGYFAEDKIA
NT seq 3699 nt   +upstreamnt  +downstreamnt
atgaactcaagagtacaggtgtcttatcaacctattattgatattgaatttagtggctta
cacttaattgaagcttcggcaggtacaggaaaaacctataccttatcaagtttgatggtt
cgtatctttcttgaaaagtatttgcctagacaagtgattgcaaccacgtttacccgtgct
gccgctgccgagttaaaaagtcgtattcgcgcccgtttagtcgaaacgtatcgttattta
gagaccaagcgtagttttacagaacacgaattaattacgcaggctgagcaagagcctgac
ttattactccaacatattttaaaaagctttgcgacgcgtattgcctatgcgtgtgaacgt
ttaaaactggtcatcgatcaattagacgagttatttgtcgggacactcgatagctttagc
caaaaactgttacgtgagtttgcctttgagagtggcaaaattgagcgcgctcaaattacc
gatgatgccaaaacttatagccgacaactgattcatgatgttttgcgtgaatggatacag
tctcaacctcaaaacgtgattgatgctttatatctggcaggtgagcttaagaatgtcgat
agttttgttaaacttgttgaagactcacttaactttagttctgctcattttaagcttcct
gaaaagccaaacattcagtttgaacaacttgctcagctcaaacagttggcgacagaaatt
gacttaagccttttagaaaactattaccagcttgatggtgaacactataaacatgtgagc
ggcacaatatttcggaatggggcatttaacaaattatttagtgaatgtttgccgcagctt
ttgcaagttctaacgcaaagcgacagcattttggtttttgatggatctatgacagcacaa
cgtgagcttgtttttaagtttttaggtcaacttgccgatcagaaagttttcaagaaatgt
cctgctgaaatttcagatggtttctatcaacatccttgtattcaacagattcaacagcta
tttggtgtgctaaaaaattacgctgagcagttcgaccagcttcatatttttttaaaagcc
tatttgtgtgtagaggtgaaaaaacgtttacctcaggttttgcaaaataaaggtgaaact
actttttctcagcaaattcgtacactttctgaagctttaaaaggtgagcaggggcagcgt
tttgctgtatttgttcaggcacgttatcccttaattttggtcgatgaatttcaggatact
aaccaagatcaagacgatatgctggcgaacatttggcgccatccagagcgctaccaaaaa
ggctgcatgattatggtgggtgaccgtaaacaggcgatttacggtttccgtggtggggat
atgctcaccttcttaaatgcctataaagatattcaagctaaacatggtcgtgaatataag
ttaattcataaccatcgttccgttgctgatctggttgaagtggtcgatgccttatttcaa
cgacaaattgatttcggcgaagaggttcaatatgacccaattcgagcaggaactcggcct
catcctgtactgattgagcagaataatcataatcctcatcctttacgttggctcatgctc
aaagataaagaaactgaggcacagcaagttgcttggaagattcgagatctactcaatcag
tcacatgctggacaactatattttcagaaagatgctcagactcaagctctaaacgaagat
gatattgcggtattgtctcgtaatcatgatgggcttgataaagttcaatttgagctagag
cgtttaggaattcgggttaacaggccatcaaaacgaagtgttttcgattgcacagttgcg
caagacgttggtgctttgttgactgccatacttcatccttacgatgaggcaaaagtgaag
cgagctttaattagccgtctatttgccatggatttaaaacaactcttacagcttgagcag
acagccgaagggttaagccagtttatgactggttttgatagcattagagagttgtggtcc
gctcaaggctttttagtagcatggcaacaatgtctcatccaatttgatatatggcaaaat
ttggtcgctgcccaaagtaaagataatgaacgggttgtggtgaacttgcgtcatttgact
gaaattttgagtcagcacagtgagaaatactcaggcgcgcaaaacctctatcattggtat
ctcaaacagttgagttctcctctggatcgtgattgggagttagagcgtaaattgtcgagt
gaagctggtgttcagctcatgacaattcaccagtcaaaaggactggaatttaagattgtt
ttcttattaggtgcagacaagccctttcgagaaaataacaaaactctgaatttttcgacc
caagatgtagtccaaccagactcaagtcagaccttaactcaacgtgtcgttgcgattgct
gataagacttatttgaatgaagttgaacttaagcaacacgaagaacgagcgcttgctgaa
cagaatcgcctttggtatgtggctttaacgcgagcaagccaccgcgtctatgcactttta
caagatcttgatggtaaatcagtatcaggcctcgcgttttggaaaaataggactgagcct
tttcagcaccgttgctgtacggatgaaatggttttggagcagattccacaggcaattcat
ttagccaaacaaacaagtattattgaaatacaagcacaacggtttcctgaacagcgtttt
tattcgagaggtaaaaccagtttcagttacttggcacagcatttaaaacataaagctggc
acagatttattagtgagtcagagcgatgatgctgtattagcagaagatgagctggattta
attaacactgctgaggcaatcagtgctcagccgattgattggataaagagtaacttcccg
cgaggaacgcttgccggtaatttcttacatgaaatctttgagcacatcaattttcaatgt
tcagatgactgggtaagtgaaatacgtcgtcgttttaaaaatgactatagtagtctttgg
caagatttacttaataaatataacgagagcttcccagagcaagaagatgccgagaatctg
ctttaccagtcagttgcagagtggctgaaagatattttgcgaacgccgcttgatcaaagt
ttccgactaaatcagcttcaacaagagcagtatttgtcagagtttcctttttatttggcg
ttgtcagatcgggttctagcgatgacacgtattcagcagcttttcgctgagtatgggttg
aatatgccggaattacttgaggctcgctcagcacgttacctcaatggttctatcgatttg
gtctattttgatgggcagcgttaccacattgccgattataaaagtaattacttaggtgat
gatcttgcagattatcgtagcgatagcattgcccaaagcatgtctttagcaagttattgg
ctacaggcaggtttatatctcgttgcattacatcgctatttgcaagtcaaaatgcaggat
taccaaattgagcaacacttaggtggggcaacttatctttatttacgtggtatgaatggt
gaagctgagcagggctattattactggcagcctagcattgagtttattctgcgtcttgat
gccattttagggtattttgctgaggataaaattgcatga

DBGET integrated database retrieval system