KEGG   Acinetobacter oleivorans: AOLE_17880
Entry
AOLE_17880        CDS       T01263                                 
Symbol
uvrC
Name
(GenBank) excinuclease ABC subunit C
  KO
K03703  excinuclease ABC subunit C
Organism
acd  Acinetobacter oleivorans
Pathway
acd03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    AOLE_17880 (uvrC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_17880 (uvrC)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AOLE_17880 (uvrC)
SSDB
Motif
Pfam: UvrC_RNaseH_dom GIY-YIG UVR HHH_5 HHH HHH_2
Other DBs
NCBI-ProteinID: ADI92460
UniProt: D8JHR4
LinkDB
Position
complement(3810377..3812131)
AA seq 584 aa
MTQLPGVYKMLGKEGELLYVGKAKNLKNRVSSYFVKTIEHPKTQALVARIYDIETLVTRS
ETEALLLEQNLIKQHRPPYNIMLRDDKSYVYIFVSADKPYPRLASGRGKGKHQIGKFFGP
YPSAYSARDTLLVLQKLFNVRQCENSYFAQRKRPCLQYQIKRCSAPCVGLISPEDYKEDI
NNSIRFLQGDTKELNQELIAKMEQAAAELEFEKAVFYRDRLSLLREVQAQQAVFKVKGEA
DILAIAYQAGVTCVQIMYVRNGRMLGGKSYFPDMLGDDLGQMLSDFMANFYFQVADEVPN
ELIVNIALPDRKELEEALTQQFGKKVQIKSNVRETRAEWLELAEMNVQHAIKGQLSNHLE
LNERFHQLEQVIGRPVDRIECFDISHTMGEAPIASCVVFDQGGARKRDYRQFAIQDITAG
DDYAAMRQALTRRYKKAILPDLLLIDGGKGQLHMAMEVMQELGLDAFMVGVSKGEGRKPG
LETLHFTDGTKIQLPEDHKALHLIQQVRDEAHRFAITKHRAKRDKRRSISVLEAIPGLGP
KRRRDLLTHFGGIQGVLKASEKELTLVPGFGEMMARTIYKILHE
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgacccaacttccaggtgtttataaaatgctagggaaagagggcgaattgttatatgtt
ggcaaagcaaaaaacctaaagaatagggtgtcgagctattttgttaaaaccattgagcat
cctaaaactcaggctttagttgccagaatttatgatattgaaactttagtcactcgttca
gaaactgaagcactacttctcgagcaaaatttaattaaacaacatcgtccgccttataac
atcatgttgcgggacgataagtcatatgtctatatttttgtatcggcagataagccctat
cctcggcttgctagtggtcgcggcaaagggaagcaccaaattggtaagttctttggacct
tatccaagtgcctatagtgcccgtgatactttactcgttctacaaaagctttttaatgta
cgtcagtgtgaaaatagctactttgcgcagcgcaagcgcccgtgtttgcaatatcagatc
aaacgttgttctgcaccttgtgtagggctgatttcacccgaagattataaagaagacatt
aataatagtattcgctttttgcaaggtgatacgaaggagctgaatcaagagctcattgcc
aaaatggaacaagcagcagcagaacttgaatttgaaaaagctgttttttatcgtgatcga
ctatctttgcttcgtgaagttcaagcgcaacaagctgtgtttaaagtcaaaggtgaggcg
gatattctggcgattgcttatcaggctggcgtgacatgcgtgcagattatgtatgtacgc
aatgggcgaatgctaggtggaaaaagctatttccctgacatgctaggcgatgaccttggg
caaatgctgagtgactttatggcaaacttttactttcaagttgcagatgaagtacccaat
gaattgattgtgaacattgcattgcctgaccgtaaagaattagaagaagcattgacacag
cagtttggcaaaaaggttcagattaagagtaatgttcgagaaactcgtgctgagtggcta
gagttagctgaaatgaatgttcaacatgcaattaaggggcagttgagtaaccatttagaa
ctcaatgaacgtttccatcagttagagcaagtaattggtagacctgtcgatcgtatcgaa
tgttttgatattagccataccatgggcgaagctccaattgcgtcgtgtgtggtgtttgac
caaggtggtgctcgtaagcgtgactatcgccaatttgccattcaagatattaccgctggc
gatgactatgcagctatgcgccaagccttaacacgacgttataaaaaagccatattgcct
gatctgttgttaattgatggtggtaaaggtcagcttcacatggcgatggaagttatgcaa
gagcttgggctcgatgcttttatggtgggggtatcgaaaggtgaagggcgtaaaccgggc
cttgagaccctgcattttacagatggcacgaaaatccagttaccagaagatcataaagca
ttgcacttgattcaacaggtacgtgatgaagcccatcgcttcgcaattactaaacaccga
gctaaacgtgataaacgccgtagcatttcagttttagaagcgattccgggattgggtcca
aagcgccgtcgagatttattaacccattttggtgggattcaaggtgttttaaaagcctct
gaaaaagagctcacgcttgtgcctggttttggtgaaatgatggccagaacgatttataaa
attctgcatgaataa

DBGET integrated database retrieval system