KEGG   Acinetobacter oleivorans: AOLE_17995
Entry
AOLE_17995        CDS       T01263                                 
Name
(GenBank) DNA-directed RNA polymerase subunit beta'
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AOLE_17995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acd03021]
    AOLE_17995
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_17995
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AOLE_17995
Transcription machinery [BR:acd03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     AOLE_17995
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      AOLE_17995
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 Peptidase_M23 Apocytochr_F_C
Other DBs
NCBI-ProteinID: ADI92483
UniProt: D8JHT7
LinkDB
Position
complement(3832307..3836500)
AA seq 1397 aa
MKDLLDIMRKKTDSDGHAPIEFDRIRIGLASPEMIKSWSHGEVKKPETINYRTFKPERDG
LFCAKIFGPVKDYECLCGKYKRMKYKGVICEKCGVEVTTAKVRRERMGHIELASPVAHIW
FLKSLPSRIGLLLDMTLRDIERVLYFESYVVTDPGMTPFEKYQLLTDEEYFNALEEHGDE
FTAKMGAEAIQDLLKDIDLEAEIARLREEIPQTTSETKLKKASKRLKLMEAFNDSNNKPE
WMVMNVLPVLPPDLRPLVPLEGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNE
KRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVI
TVGPTLRLHQCGLPKKMALELFKPFIFAKLQASGQATTIKAAKKMVERETPEVWDVLASV
IRQHPVMLNRAPTLHRLGLQAFEPILIEGKAIRLHPLVCAAFNADFDGDQMAVHVPLTLE
AQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYITRDAVNAKGEGMVFADTHEVNR
ALATGQVAIHARVKVRVHQTVINENGEREHGTIIVDTTPGRCLLWEVVPQGLSFDMINLE
MTKKNISKLINSCYRKLGLKDTVIFADQLMYLGFRQATRSGVSVGMEDMLIPPTKHTIID
KAETEVREIEQQFEQGFVTAGERYNKVVDIWARTNDQVAKAMMDNLSYTLVKNKQGEDEK
QKSFNSIYMMSDSGARGSAAQIRQLAGMRGLMAKPDGSIIETPIKANFREGLTVLQYFIS
THGARKGLADTALKTANSGYLTRRLVDVAQDLVITEPDCGTAGGLVMTPFIQGGDVIEPL
RDRVLGRVTAEDVRRASDDEVVLPRGTLIDEKIAAHLEEAGVDEVKVRSVIACESAFGVC
ARCYGRDLARGHLVNPGESVGVMAAQSIGEPGTQLTMRTFHVGGAASRTSAANSVQVRNK
GTVRFHNVKTVQHAKGHLVSVSRSGEIGIADDLGRERERYKLPYGASILLKDGEAVEAGG
IVATWDPHTHPLVTEVAGKARFSQIADGVTATSKTDDATGMTTVEILPVTARPASGKDLR
PAIVLDTTDGGEQFYFLPQNTIVTVRDGETIGVGDVIGRVPQETSRTRDITGGLPRVADL
FEARKPKEHAILAEVSGVVSFGKETKGKNRLVITPDDGSEIYEELIPKWRQINVFEGEHV
NRGETVSDGPQNPHDILRLKGEVALTNYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKV
DITDGGDTSFIKGEQVDYIRVVQENQAVLAQNKFPAKFERQLMGITKASLSTDSFISAAS
FQETTRVLTEAAVTGKEDDLRGLKENVVVGRLIPAGTGLAYHLERRRQEAEAAEHELHND
FSEVDQAFSQALNSEQF
NT seq 4194 nt   +upstreamnt  +downstreamnt
ttgaaagacttgctcgatatcatgcgtaagaaaacggactcagatggtcatgcaccaatt
gagtttgaccgtatccgtattggtcttgcgtcaccagaaatgattaagtcatggtctcat
ggtgaagttaaaaaacctgagacaattaactaccgtacttttaaaccagaacgtgacggt
ttgttctgtgccaaaatttttggtccagtaaaagattacgaatgcttgtgtggtaaatac
aagcgtatgaaatacaaaggcgtcatttgtgaaaaatgtggcgttgaagtaactacagcg
aaagttcgtcgtgaacgtatgggtcacattgaactcgcttctccagttgcacatatctgg
ttcttaaaatcgttaccatctcgtatcggtttattacttgatatgacgcttcgtgatatc
gaacgcgtattgtatttcgaatcatacgttgtaactgatcctggtatgactccgtttgaa
aagtatcaacttttaacagacgaagaatacttcaatgcacttgaagagcacggtgatgaa
ttcactgcgaaaatgggtgcagaagcgattcaggacttattaaaagatatcgatcttgaa
gctgaaatcgcacgtttacgtgaagaaattcctcagacaacttctgaaacgaagttgaaa
aaagcgtctaaacgcttgaaattgatggaagcattcaacgattcaaacaacaagccagaa
tggatggtgatgaatgtacttcctgtacttccacctgatttacgtccattagttccactt
gaaggtggtcgtttcgcgacttctgacttgaacgatttatatcgtcgtgtcattaaccgt
aacaaccgtttgaagcgtcttcttgatcttgcagcaccagacattatcgtacgtaacgaa
aaacgtatgttacaagagtctgtagatgcattgcttgataacggtcgtcgtggtcgtgca
attactggttctaacaaacgtccattaaaatctttggcagatatgatcaaaggtaaacaa
ggtcgtttccgtcagaacttacttggtaagcgtgttgactattctggtcgttcggtaatt
actgtaggtcctactttacgtcttcaccaatgcggtcttccgaagaaaatggcacttgaa
ttattcaagccatttatttttgcgaaactacaagcttcaggtcaagcaacaaccattaaa
gctgcgaagaaaatggttgagcgcgagactccagaagtttgggacgttcttgcttctgta
attcgtcaacatccagtaatgttgaaccgtgcgccaacacttcaccgtttaggtcttcaa
gcatttgaacctattcttattgaaggtaaggcaatccgtcttcacccactcgtttgtgct
gcgtttaacgccgacttcgatggtgaccaaatggcggtacacgttccattgacacttgaa
gcgcagttagaagctcgtgcattgatgatgtcaacaaacaacatcttgtcaccagcgaat
ggtgagccgatcatcgttccttcccaggacgttgtcttgggtctttactacatcacgcgt
gatgcagtaaatgctaaaggcgaaggcatggtgtttgctgatactcacgaagtaaaccgt
gcacttgcaactggtcaggttgcgatccatgctcgtgttaaagtacgtgtgcatcaaact
gttatcaatgaaaatggtgaacgtgaacacggaactattattgttgatacgacaccaggc
cgttgtttgctttgggaagttgttccacaaggcttaagctttgacatgatcaaccttgag
atgactaaaaagaatatctcgaagttaatcaactcttgctaccgtaaacttggtttgaaa
gataccgttatctttgctgaccaattaatgtacttgggcttccgtcaagcgactcgttca
ggtgtatctgtaggtatggaagacatgttgattccacctactaagcacacaattattgat
aaagcagaaacagaagttcgtgaaatcgaacaacagttcgaacaaggtttcgtaactgct
ggtgagcgttataacaaagttgtcgatatctgggcgcgtacaaacgaccaagttgctaaa
gcgatgatggataacttgtcttatacacttgtgaaaaataaacaaggtgaagacgagaaa
caaaaatcattcaacagcatctatatgatgtctgactctggtgcccgtggtagtgcggca
cagattcgtcagcttgctggtatgcgtggcttgatggcaaaaccggatggttcgattatc
gaaacaccgattaaagcgaacttccgtgaaggtttaacagtacttcagtactttatttca
acacacggtgcgcgtaaaggtttggccgatacagcattgaaaactgcgaactctggttac
ttgactcgtcgtcttgtagacgtagcacaagatttggtaattactgagcctgactgtggt
acagctggtggtttggtaatgactccattcattcaaggtggtgatgtcattgagccatta
cgtgaccgcgtattaggtcgtgtaactgctgaagacgtacgtcgtgcatctgatgatgaa
gttgtattacctcgtggtacgttaattgacgaaaaaatcgcagctcatcttgaagaagcg
ggtgtggatgaagtcaaagtacgttcagtaattgcttgtgaatctgcttttggtgtatgt
gctagatgttatggccgtgaccttgcacgtggtcacttggttaacccaggtgaatcagtt
ggtgtaatggcagcacaatctattggtgaaccaggtacacagttaacgatgcgtacgttc
cacgttggtggtgctgcgagccgaacttctgctgcaaacagtgttcaagtacgtaataaa
ggtactgtacgtttccataacgtgaaaactgtacaacatgcaaaaggccacttggtttca
gtttcacgttcaggtgaaattggtattgccgatgacttaggtcgtgagcgcgagcgttat
aaacttccttacggtgcaagcatcttgttgaaagatggtgaagctgtagaagctggcggc
atcgtagcgacttgggatccgcatacacatccattagtaacagaagttgctggtaaagca
cgtttcagtcaaatcgctgatggtgtaactgcaacatcgaaaactgatgatgcaactggt
atgactactgttgaaatcttgcctgtaacagctcgtcctgcttctggtaaagatttacgt
cctgcaatcgtgttggatacaacagatggcggcgaacagttctacttcttgccacaaaac
acaatcgtaactgttcgcgatggcgaaacgattggtgtcggtgacgtaattggtcgtgta
ccacaagaaacatcacgtactcgtgatattaccggtggtcttccgcgtgtagctgactta
ttcgaagcacgtaaaccgaaagaacatgcaattcttgctgaagtttcaggtgttgtaagc
ttcggtaaagaaactaagggtaaaaaccgtttagtaattaccccagatgatggttctgag
atttacgaagaattgattccaaaatggcgtcaaatcaacgtgttcgaaggcgagcatgtg
aaccgtggtgaaacagtttctgatggtccacaaaacccgcacgacatcttacgtttgaaa
ggtgaagttgcattaactaactacatcgtgaacgaagttcaagacgtataccgtctccaa
ggtgtaaaaatcaacgacaaacatattgaagttatcgtacgtcaaatgttgcgtaaagtt
gatatcactgatggtggcgatacaagcttcatcaaaggcgagcaagtggattacatccgc
gttgttcaagagaaccaagctgtcttggctcagaacaagttccctgcgaagtttgaacgt
caattgatgggtattacgaaagcatcgctttctacagactcgttcatctctgctgcatcg
ttccaggaaacaactcgtgtgttaactgaagctgctgtaacaggtaaagaagatgattta
cgtggcttgaaagaaaacgttgtagtcggtcgcttgattccagctggtactggtcttgca
taccacttagaacgtcgtcgtcaagaagcagaagctgctgaacatgagcttcacaatgac
ttcagcgaagtagaccaagcatttagccaagcattaaactcagaacaattctaa

DBGET integrated database retrieval system