KEGG   Acinetobacter oleivorans: AOLE_18000
Entry
AOLE_18000        CDS       T01263                                 
Symbol
rpoB
Name
(GenBank) DNA-directed RNA polymerase subunit beta
  KO
K03043  DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
acd  Acinetobacter oleivorans
Pathway
acd03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:acd00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    AOLE_18000 (rpoB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acd03021]
    AOLE_18000 (rpoB)
   03400 DNA repair and recombination proteins [BR:acd03400]
    AOLE_18000 (rpoB)
Enzymes [BR:acd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     AOLE_18000 (rpoB)
Transcription machinery [BR:acd03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     AOLE_18000 (rpoB)
DNA repair and recombination proteins [BR:acd03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      AOLE_18000 (rpoB)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpb2_2 RNA_pol_Rpb2_45 RelB DOCK-C2
Other DBs
NCBI-ProteinID: ADI92484
UniProt: D3JTG1
LinkDB
Position
complement(3836587..3840675)
AA seq 1362 aa
MAYSYTEKKRIRKNFGKLPQVMEAPYLLSIQVDSYRTFLQGGKSPKNREDIGLQAAFRSV
FPIESYSGNAALEFVEYSLGKPEFDVRECILRGSTYAAPMRVKIRLIIKDRETKSIKDVR
EQEVYMGEMPLMTDNGTFVINGTERVIVSQLHRSPGVFFDHDKGKTHSSGKVLYSARIIP
YRGSWLDFEFDAKDLVYVRIDRRRKLLATVVLRALGYNNEQILNLFYEKVPVYLDMGSYQ
IDLVPDRLRGEMAQFDIADNDGKIIVEQGKRINARHVRQMEASGLAKLSVPDEYLYERIT
AEDITLRNGDVIAANTLLSHEVMVKLAEGGVKQFNILFTNDIDRGSFVADSLRADTTSGR
EEALVEIYKVMRPGEPPTKEAAENLFNNLFFSSERYDLSPVGRMKFNRRLGRPYEVGTDQ
KSREVEGILSHEDIIDVLRTLVEIRNGKGEVDDIDHLGNRRVRSVGEMTENQFRVGLVRV
ERAVKERLSQAETDNLSPQDLINAKPVAAAIKEFFGSSQLSQFMDQNNPLSEITHKRRVS
ALGPGGLTRERAGFEVRDVHQTHYGRVCPIETPEGPNIGLINSLSVYAKANDFGFLETPY
RKVVDGRVTDAVEYLSAIEEVGTVIAQADSAVDKDGNLTEEFVSVRHQGEFVRIPPEKVT
HMDVSAQQVVSVAASLIPFLEHDDANRALMGSNMQRQAVPTLRADKPLVGTGMEANVARD
SGVCVIANRGGAIEYVDASRIVIRVNEDEMIAGEAGVDIYNLIKYTRSNQNTCINQNIIV
NLGDKVARGDILADGPSTDMGELALGQNMRVAFMTWNGYNYEDSILLSERVLQEDRLTSI
HIQELSCVARDTKLGAEEITADIPNVGEAALSKLDESGIVYIGAEVTAGDILVGKVTPKG
ETQLTPEEKLLRAIFGEKAADVKDSSLRVPSGTKGTVIDVQVFTRDGLEKDDRALAIEKA
QLDSYRKDLKEEYKIFEEAARERVIRLLKGQESNGGGSTKRGDKLVEDMLSGLELVDLLE
IQPTDEAIAERLSQIQVFLKEKSAEIDEKFAEKKRKLSTGDELTTGVLKVVKVYLAVKRR
IQPGDKMAGRHGNKGVVSNILPVEDMPHDANGVPVDIVLNPLGVPSRMNVGQILETHLGM
AAKGLGDKIEKMLKEQRTVLELREFLDKIYNKVGGEQEDLDSLTDAEVLALSGNLRAGVP
LATPVFDGAEESQIKDLLELADISRTGQTVLFDGRTGEQFDRPVTVGYMYMLKLNHLVDD
KMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVEGR
TRIYKNIVDGNHYMDPGMPESFNVLTKEIRSLGINIELKNGD
NT seq 4089 nt   +upstreamnt  +downstreamnt
atggcatactcatataccgaaaagaaacggatccgtaagaattttggtaaattgccccaa
gtaatggaagcaccgtacttactttcgattcaggtcgattcgtatagaacgttcttgcaa
ggtggcaaatctccaaaaaaccgcgaagatatcggtctccaagccgcatttcgttcagtt
tttcctatagaaagttattctggcaatgctgctttagaatttgttgagtatagccttggt
aagcctgagtttgatgtgcgtgaatgtattttacgtggttcgacttatgcggcaccaatg
cgcgtaaaaattcgtttgattattaaagatcgcgaaactaaatctattaaagacgtacgt
gaacaagaagtctacatgggtgaaatgccacttatgacagacaatggtacctttgttatc
aatggtactgagcgtgtaattgtatctcaattacatcgttcacctggtgtgttcttcgat
cacgataaaggcaaaacacattcaagtggtaaagtactttattctgcacgtattattcct
taccgtggttcatggttagatttcgaatttgatgctaaagatttagtttatgtacgtatt
gaccgtcgtcgtaaattattagcaactgttgtgttgcgtgcattgggttataacaatgaa
caaatcttgaatttgttctatgagaaagtgcctgtatatcttgatatgggtagctatcaa
attgacctcgttccagatcgtctgcgtggcgaaatggcgcagtttgatattgctgacaat
gacggtaaaatcattgttgaacaaggtaaacgtattaatgcacgtcatgtacgtcaaatg
gaagcttctggtttagctaagctatcagttcctgacgagtacttgtatgagcgtatcact
gctgaagacattactttacgtaatggtgatgtgattgctgcaaatacattgttaagccat
gaagttatggtgaaactagcagaaggcggcgttaaacaattcaatatcttgtttacgaac
gatattgaccgtggttcatttgttgctgactcattacgtgctgacacaacatctggtcgt
gaagaagcattagttgaaatctataaagtaatgcgtccaggcgagccaccaacaaaagaa
gctgctgaaaacttatttaataacttattcttctcttctgaacgttatgacttatctcca
gtaggtcgtatgaagttcaaccgtcgtttgggtcgtccatacgaagttggtactgaccag
aagtcacgtgaagtagaaggtattttatcgcacgaagatatcatcgatgtattacgtaca
ttagttgaaatccgtaacggtaaaggtgaagtcgacgatatcgatcacttgggtaaccgt
cgtgtacgttctgttggtgaaatgactgaaaaccaattccgtgttggtttagttcgtgtt
gaacgtgctgttaaagaacgtttaagccaagcagaaacagataatttgtctccgcaagat
ctcattaacgcaaaaccagttgcagctgcaatcaaagaattctttggttcaagccaattg
tctcagtttatggatcaaaacaacccattatctgaaattacacataaacgccgtgtttca
gcgcttgggcctggtggtttaacgcgtgaacgtgcgggctttgaagtacgtgacgtacat
caaactcactatggtcgtgtatgtccaattgaaacgcctgaaggtccaaacattggtttg
atcaactcgctttcagtttatgcaaaagcaaatgattttggtttcttggaaacaccttac
cgtaaagtggtagatggccgagtaactgatgctgttgaatacctttctgctattgaagaa
gtaggtactgttattgcacaggccgattctgctgtagataaagatggtaacttaacagaa
gagtttgtttctgttcgtcatcaaggtgaattcgtacgtattccacctgaaaaagtgacg
catatggatgtatctgcacagcaggttgtatctgtagctgcatcacttattccattcctt
gaacacgatgacgcgaaccgtgcattaatgggttcaaacatgcaacgtcaggccgttcct
actctacgtgcggataaaccgcttgtaggtacaggtatggaagcgaacgtagcacgtgac
tctggtgtatgtgtgatcgcaaaccgtggtggtgcgattgaatatgtagatgcttctcgt
atcgttattcgtgtaaacgaagatgaaatgattgcgggtgaggctggtgtagatatttac
aacctcattaaatatacacgttctaaccaaaacacttgtattaaccaaaatattatcgtg
aatttgggcgacaaagttgctcgcggtgacattttggcagacggtccgtcaacagatatg
ggtgagcttgcgcttggtcaaaacatgcgtgtagcgttcatgacgtggaatggttacaac
tacgaagactcgatcttgttatctgagcgtgtacttcaagaagaccgtttaacttctatt
catattcaagaattatcatgtgtagcacgtgatactaagttaggtgcagaagaaattact
gccgatattcctaacgtaggtgaagctgcactttctaaacttgatgaatcaggtatcgtt
tatatcggtgctgaagttactgctggtgacatccttgttggtaaagtaacgcctaaaggt
gaaactcagttaactcctgaagaaaaattgcttcgtgcaatcttcggtgagaaagcagct
gacgttaaagactcatctttacgtgttccatctggtactaaaggtacagttatcgatgtt
caagtcttcactcgtgatggcttagagaaagatgaccgtgcgttagcaattgaaaaagca
cagcttgactcttaccgtaaagacttgaaagaagaatacaagatctttgaagaagcagct
cgtgagcgtgtaattcgtttgcttaaaggccaagaatctaacggtggtggttcgactaaa
cgtggcgacaaacttgttgaagatatgttgtctggtttagagcttgttgacttacttgaa
atccaacctacagacgaagcaattgctgaacgtttatctcaaattcaagtgttcttgaaa
gagaagagcgcagaaattgatgagaagtttgcagagaagaaacgtaagctttcgactggt
gatgagttaacaacaggcgttctgaaagttgttaaagtttacctagcagttaaacgtcgt
attcagcctggtgataaaatggctggtcgtcacggtaacaaaggtgttgtatctaacatt
ttacctgttgaagacatgccacacgatgcgaacggtgtaccagtagatatcgtattgaac
ccattgggtgtaccatctcgtatgaacgtgggtcagattcttgagactcacttgggtatg
gcggctaaagggcttggcgataaaatcgaaaaaatgttgaaagaacagcgtacagtttta
gaacttcgcgaattcttagacaagatttataacaaagttggtggcgagcaagaagatctt
gatagcttaactgatgctgaagttttagctctttctggcaacttacgtgctggtgtgcct
ttagctactcctgtatttgatggtgctgaagaaagccaaattaaagacctacttgaatta
gctgacatttcacgtactggtcaaacagtattgtttgatggtcgtacgggtgaacagttt
gatcgtcctgtaactgtaggttacatgtacatgctcaaattgaaccacttggttgatgac
aaaatgcatgcgcgttcaactggttcttactcacttgttacacaacaaccgcttggtggt
aaagcacagttcggtggtcagcgtttcggtgagatggaggtctgggcacttgaagcttac
ggtgcagcatatactcttcaagagatgttaactgttaagtcggatgacgttgaaggtcgt
acacgcatctataagaatattgtagatggtaaccattatatggatccgggtatgcctgaa
tcgttcaacgtattgaccaaagagatccgttctttaggtatcaacattgaactgaaaaat
ggtgactaa

DBGET integrated database retrieval system