KEGG   Atta cephalotes (leaf cutting ant): 105618529
Entry
105618529         CDS       T04923                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
acep  Atta cephalotes (leaf cutting ant)
Pathway
acep00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:acep00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105618529
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:acep00199]
    105618529
Enzymes [BR:acep01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105618529
Cytochrome P450 [BR:acep00199]
 Cytochrome P450, animal type
  CYP306 family
   105618529
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105618529
NCBI-ProteinID: XP_012055452
UniProt: A0A158ND44
LinkDB
Position
Unknown
AA seq 488 aa
MIILLIFLGVFLIFLVYIFRKNRKTHRLPPGPSGIPLFGYLPWINSKRPHVSFTELARKY
GPICGLQMGSVYTVLLSDPQLVRQAFSKDTFAGRAPLYLTHGIMQGYGLICAEGNLWKDQ
RRFVAGCLKNFGMTKLPGIKRDRLEERILAIVNEYTSKLKKLTMEDGIDPCETLHHYLGN
VMNDIVFGKVYKEDDEVWKWLRHLQEEGVKHVGIAGPLNFLPFFRFLPRYGKVMELLIDG
KLKTHQHYQTIIDEHRARPEKMDNFLAAFDDAMNTDTNNEHFTQQQFYHLLADLYGAGVD
TTFATFRWFLLFMAAYPDEQKKIQDEMDELLGQKVPTLEDRLILIRLEAAIAETQRLRSV
TPVGIPHGTTEDTQIGDYDIPKGTMIVPLQWAIHTDPSFWHDPLSFKPERFIAEDGSLIK
PKAFLPYQAGKRMCVGDELSRMTLFLFGARILHSFVLSVPSGMRLDLEGECGITLVPKPH
RLIFTPRE
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgataatccttttaattttcctcggcgtatttctcatatttcttgtctacatctttcgt
aaaaatcgcaaaacgcatcgactaccaccgggaccatccggcatcccactgtttggttat
ttaccatggataaattcgaaacgtcctcatgtgtcgttcacggaactggcgaggaaatat
ggtccgatttgtgggctacaaatgggttctgtgtacacagtattgttatcagatccgcag
ctggtaaggcaggctttctccaaggatacgtttgccggccgggctccattatacttgacg
catggaattatgcagggatatggccttatttgcgccgagggtaacctttggaaagaccaa
agaagatttgtagccggatgcctgaagaatttcggtatgacgaagttacccggcatcaag
agggacagactggaggaaagaatccttgcgatcgtgaacgagtacacatcgaaactgaaa
aaacttactatggaagatggtattgatccatgcgagacgcttcatcattacctgggtaac
gtaatgaacgacatcgtgtttggtaaagtttacaaagaagatgacgaagtatggaaatgg
ctgagacacttgcaagaagaaggagtcaagcacgttggaatcgcagggccactcaacttt
ttgccattcttcagatttttgccacgatatggcaaagtaatggagttacttatcgatggt
aaactaaaaacacatcaacattatcaaacaatcatcgatgagcatcgtgctcgaccagag
aaaatggataatttccttgcggctttcgacgatgcaatgaataccgatacgaataatgaa
cacttcacacaacagcaattttatcatctactagccgacctttatggtgcaggcgttgat
actactttcgcaacttttcgttggttcctcctgttcatggcagcatatccagacgaacaa
aaaaaaattcaggatgaaatggatgagctattgggacaaaaggtccccactctggaggac
aggctaatcttaattcgactagaggcagccattgcggaaacacaaagattgcgaagcgta
acaccggtcggcattcctcatggaacaacagaggatacacaaataggcgattacgacata
ccgaaaggtaccatgattgttccattgcaatgggctattcatacagatccttcgttttgg
cacgacccgctctcgtttaaacccgagagatttattgctgaggacggaagtctcatcaag
ccgaaagcctttctaccgtaccaagcaggtaaacgtatgtgcgtcggtgatgaactgtca
aggatgacattatttttattcggcgcaagaattcttcattcattcgttctgtccgtacca
tccggcatgcgcctcgatctggaaggcgagtgcggaattaccctggttccaaaaccacac
cgcttgatttttacaccacgagaataa

DBGET integrated database retrieval system