KEGG   Apis cerana (Asiatic honeybee): 108002654
Entry
108002654         CDS       T07475                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
acer  Apis cerana (Asiatic honeybee)
Pathway
acer00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:acer00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    108002654
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:acer00199]
    108002654
Enzymes [BR:acer01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     108002654
Cytochrome P450 [BR:acer00199]
 Cytochrome P450, animal type
  CYP306 family
   108002654
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 108002654
NCBI-ProteinID: XP_016919933
LinkDB
Position
Unknown
AA seq 498 aa
MNLEHYAIFILSFLLLVYILRKNRKARRLPPGPWQLPLLGYLPWIDAEKPHETLTKLSRV
HGPVCGFRMGSVYTVLLSDPQLIRQSFAKDSITNRAPLYLTHGIMKGYGIICAEGEQWKD
QRKFISNCLRNFGMVKHEGAKRDKMEKRISDAVNECVSVLRNRAANGPIDPLDTLHHCLG
NLINSIVFGKTYEEEDQIWKWLRHLQEEGVKQIGVAGPLNFLPFLRFLPQYGRVIRSIVD
GKDKTHEIYRQILDEHRARLESENGCKIDSFLAAFDEQMRKKNSAELRYFTEPQLYHLLA
DLFGAGTDTTLTTLRWFLLFMAAHPMEQEKVQSEMDLCLKEGEQPTLNDRIAMPRLEAAI
AEVQRIRSVTPLGIPHGTSEDVQIGGYDIPCGAMIVPMQWAVHTDPAYWHDPLEFRPDRF
LSDDGTFFKPESFLPFQNGKRVCVGEELARMILFLFAGRILRAFVVSVPPDEMADLEGEC
GITLVPKPHRLAFIERDR
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaatctcgaacattacgcgatattcattttatcttttctccttctcgtatacatcctt
cgcaaaaatcgaaaagcccgtcgtctaccgcctggtccttggcaacttccgctccttggc
taccttccatggatcgacgcggaaaagcctcacgaaactctgacgaaattgtcaagagtt
cacggccctgtatgcggattccgcatgggctccgtttacaccgtcttgctgtcagatcca
caactgatacgtcaatcgtttgcaaaagattccattacgaacagagcacctttgtacctt
acccacggaatcatgaaaggttacggtataatttgcgcggagggggagcaatggaaggat
caaagaaaatttatcagcaactgtctgcggaatttcggtatggtgaagcacgagggggcg
aaacgcgacaagatggagaaacgaatatcggatgcggtgaacgaatgcgtatcagtatta
agaaatcgcgccgcaaatggcccgatcgatccattggacacgctccaccactgcttgggc
aatctcatcaatagcatcgtgtttggaaaaacgtacgaggaggaagatcaaatttggaaa
tggctgaggcatctgcaggaggagggcgtgaagcaaattggcgtcgctggcccgctcaac
tttctacccttcctcagatttctaccgcaatacggccgagtgatacggtcgatcgtcgat
ggaaaggataaaacgcacgaaatatatcggcaaatactggacgagcaccgcgcacgactc
gagtcagagaatgggtgcaagatcgacagctttttagcggcattcgacgagcaaatgagg
aagaaaaatagcgcggaactgcgatatttcacggagccgcagctttatcatttgcttgcc
gatctgttcggcgcaggaaccgacactacactgaccacccttcgttggtttctcttattt
atggctgctcaccccatggaacaggaaaaggtacaatcggaaatggacctgtgcttgaag
gaaggggaacagcccactttgaatgacagaatcgcgatgcctcgtctcgaagcagctata
gccgaggtgcaaaggataaggagcgttacccctctcggtatccctcacggaacatcagag
gatgtgcaaataggtggttacgatataccgtgcggcgccatgatcgtgcccatgcagtgg
gccgtccacacggatcccgcttactggcacgaccccctcgaatttcgacccgacagattc
ctgtccgacgatggaactttctttaaacctgaatcgtttcttccgtttcaaaatgggaaa
cgcgtttgcgttggagaggaattggccagaatgatactgttcttgttcgccggccgaatt
ctacgtgcgttcgtagtgtctgtaccaccggatgagatggccgatctcgaaggcgagtgc
ggtatcacactcgtcccgaagcctcatcggttggcgtttatcgagcgggatcgatga

DBGET integrated database retrieval system