Aphelocoma coerulescens (scrub jay): 138120959 Help Entry 138120959         CDS       T10543                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism acoe  Aphelocoma coerulescens (scrub jay) Pathway acoe04020   Calcium signaling pathway acoe04070   Phosphatidylinositol signaling system acoe04114   Oocyte meiosis acoe04218   Cellular senescence acoe04261   Adrenergic signaling in cardiomyocytes acoe04270   Vascular smooth muscle contraction acoe04371   Apelin signaling pathway acoe04625   C-type lectin receptor signaling pathway acoe04744   Phototransduction acoe04910   Insulin signaling pathway acoe04912   GnRH signaling pathway acoe04916   Melanogenesis Brite KEGG Orthology (KO) [BR:acoe00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     138120959    04020 Calcium signaling pathway     138120959    04070 Phosphatidylinositol signaling system     138120959  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     138120959    04218 Cellular senescence     138120959  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     138120959   09152 Endocrine system    04910 Insulin signaling pathway     138120959    04912 GnRH signaling pathway     138120959    04916 Melanogenesis     138120959   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     138120959    04270 Vascular smooth muscle contraction     138120959   09157 Sensory system    04744 Phototransduction     138120959  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:acoe01009]     138120959   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acoe04131]     138120959    03036 Chromosome and associated proteins [BR:acoe03036]     138120959   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acoe04147]     138120959 Protein phosphatases and associated proteins [BR:acoe01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      138120959 Membrane trafficking [BR:acoe04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     138120959 Chromosome and associated proteins [BR:acoe03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      138120959 Exosome [BR:acoe04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    138120959 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EF_EFCAB10_C EH SPARC_Ca_bdg EF-hand_11 EF-hand_EFHB_C EFhand_Ca_insen UPF0154 Dockerin_1 SAPC2_N Caleosin DUF5580_M FCaBP_EF-hand SurA_N_3 SPEF2_C Motif Other DBs NCBI-GeneID:  138120959 NCBI-ProteinID:  XP_068890191 LinkDB All DBs Position 1A:complement(2307523..2308880) Genome browser AA seq 149 aa AA seqDB search MAERLSEEKIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG SGTIDFPEFLSLMARKMRDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagaaaatcgcggaattcaaggaagcgttttccctcttt gaccgcgacggggacggctgcatcaccaccaaggagctgggcaccgtcatgcgctcgctg ggccagaaccccaccgaggccgagctgcaggacatggtgggcgaggtggacgccgacggc agcggcaccatcgacttcccggagttcctgtcgctgatggccaggaagatgagggacacg gacagcgaggaggagatccgggaggctttccgggtttttgataaggatgggaacggctac atcagcgcggccgagctgcggcacgtcatgaccaacctgggggagaagctgacggacgag gaggtggacgagatgatcaaggaggccgactgcaacaacgacgggcaggtcaactacgag gagttcgtgaggatgatgacagagaagtga

DBGET integrated database retrieval system