Anopheles coustani: 131271919 Help Entry 131271919         CDS       T10908                                  Name (RefSeq) bombyxin B-2 homolog   KO K04526   insulin Organism acos  Anopheles coustani Pathway acos04068   FoxO signaling pathway acos04081   Hormone signaling acos04140   Autophagy - animal acos04150   mTOR signaling pathway acos04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:acos00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     131271919    04150 mTOR signaling pathway     131271919   09133 Signaling molecules and interaction    04081 Hormone signaling     131271919  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131271919  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     131271919  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:acos04052]     131271919 Cytokines and neuropeptides [BR:acos04052]  Neuropeptides   Unclassified    131271919 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin SUIM_assoc Motif Other DBs NCBI-GeneID:  131271919 NCBI-ProteinID:  XP_058129485 LinkDB All DBs Position 3:complement(93326681..93335514) Genome browser AA seq 135 aa AA seqDB search MRSGFIGMNTILFVAVVVLLLLDETKGNSTPNSDALISHLTRSRYCGRRLTETLAFLCQG RYPMLTHYRTDYYHDQQQQQQRVKVEVATLPDTLPPGFPYPGTGVHRRSRRSTGGIYDEC CKKSCSYVELRAYCD NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgcgttcgggctttatcggtatgaacacgatcctgttcgtggcggtagtcgtgctactg ctgctcgacgagaccaagggcaactccacgccgaacagcgatgccctgatcagccatttg acccgctcgcgctactgcggccgccggctgacggaaacgctggccttcctctgccaggga cggtacccgatgctgacccactatcgcaccgattattaccacgaccagcaacagcagcag cagcgggtaaaggtcgaggtggccaccctgccggataccctgccgcccggatttccctac ccaggcacgggagtccatcggcgcagtcgtcgcagcaccggtggcatctacgacgagtgc tgcaagaagagctgctcctacgtcgagctgcgagcatactgtgattga

DBGET integrated database retrieval system