KEGG   Actinoplanes sp. NBRC 14428: Asp14428_14190
Entry
Asp14428_14190    CDS       T08315                                 
Symbol
rapK
Name
(GenBank) pteridine-dependent deoxygenase like protein
  KO
K18239  chorismatase [EC:3.3.2.13]
Organism
actr  Actinoplanes sp. NBRC 14428
Pathway
actr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
Brite
KEGG Orthology (KO) [BR:actr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Asp14428_14190 (rapK)
Enzymes [BR:actr01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.13  chorismatase
     Asp14428_14190 (rapK)
SSDB
Other DBs
NCBI-ProteinID: BCJ49944
LinkDB
Position
complement(1504339..1505277)
AA seq 312 aa
MDTLSCRFGDPAGVAHPLGVIRWTTAAAGPAIRHGAPALDLHVARDPGEAVTEVWTTNRP
VTSGVRDDIAYGHDGRYAFCAVSVPPAARYAPGVQDAYLRAFALLGDLGYPYVFRMWNAV
GRINEPNADGLETYRDFCRGRADAFARSPLPPGPLPAGTGVGARTDGVAFYLLARREPGH
TAVENRRQVPAYRYPVRYGPRPPAFARASRLPGGPLLVSGTASILGHETAHAGDLAAQCR
TTLENLAALADPRSLRAVKVYVRHPAHRDPVRRLLGGTLTGDVAYLTTDLCRRDLLVEVE
GMAPVPVLAGAG
NT seq 939 nt   +upstreamnt  +downstreamnt
ttggacactctgagctgccggttcggcgacccggccggcgtggcgcacccgctcggcgtg
atccgctggaccaccgccgcggccggtccggcgatccggcacggtgcgcccgccctcgac
ctgcacgtcgcccgcgaccccggcgaggcggtcaccgaggtgtggaccacgaaccggccg
gtgacctcgggcgtacgggacgacatcgcgtacggccacgacggccggtacgcgttctgc
gcggtctcggtgccgcccgccgcccggtacgcgcccggcgtgcaggacgcgtacctgcgg
gcgttcgcgctgctcggcgacctcggctacccgtacgtgttccggatgtggaacgcggtc
ggccggatcaacgagccgaacgcggacgggctggagacgtaccgcgacttctgccggggg
cgggcggacgcgttcgcccggtcgccgctgccgccggggccgctcccggccggcaccggc
gtcggcgcccgcaccgacggcgtcgcgttctacctgctcgcccgccgcgagccgggacac
accgccgtggagaaccgccgccaggtgccggcctaccgctacccggtccgctacggcccg
cgcccgcccgcgttcgcccgggccagccgcctgcccggcggtccgctgctggtctccggc
accgccagcatcctcggccacgagaccgcccacgccggggacctcgccgcccagtgccgt
acgacgctggagaacctggccgcgctcgccgacccgcgctcgctgcgggccgtcaaggtg
tacgtccggcacccggcccaccgcgacccggtacgccgcctgctcggcggcacgctgacc
ggggacgtcgcctacctcaccaccgacctgtgccggcgtgacctgctcgtggaggtggag
gggatggctccggtgccggtgctggcaggagccgggtga

DBGET integrated database retrieval system