Athene cunicularia (burrowing owl): 113480759 Help Entry 113480759         CDS       T05777                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism acun  Athene cunicularia (burrowing owl) Pathway acun04144   Endocytosis acun04517   IgSF CAM signaling acun05132   Salmonella infection Brite KEGG Orthology (KO) [BR:acun00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113480759 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113480759 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113480759 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:acun04131]     113480759 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:acun04147]     113480759 (ARF6)    04031 GTP-binding proteins [BR:acun04031]     113480759 (ARF6) Membrane trafficking [BR:acun04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113480759 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     113480759 (ARF6) Exosome [BR:acun04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113480759 (ARF6)   Exosomal proteins of colorectal cancer cells    113480759 (ARF6) GTP-binding proteins [BR:acun04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     113480759 (ARF6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  113480759 NCBI-ProteinID:  XP_026705709 LinkDB All DBs Position 5 AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgggcaaggtgctgtccaagatcttcggcaacaaggagatgcggatcctgatgctgggt ctggacgcggccggtaaaaccaccatcctgtacaaactgaagctgggccagtccgtcacc accatccccaccgtgggcttcaacgtggagacggttacttacaaaaacgtcaagttcaac gtgtgggatgtcgggggccaggacaagatccgtcccctctggaggcactactacacgggc acgcaagggttgatctttgtggtggactgcgccgatcgcgaccgcatcgacgaggcccgc caggagctccaccgcattatcaacgacagggagatgcgggacgccatcatcctcatcttc gccaacaagcaggacctgcctgatgccatgaaaccccatgaaatccaggagaaactgggc ctgacccgaatcagggataggaattggtacgtgcagccctcctgtgctactacaggggat ggactctatgaagggctgacatggttaacatccaattataaatcctaa

DBGET integrated database retrieval system